Identifiers and Description

Gene Model Identifier

TTHERM_000313079

Standard Name

DTX1 (DelTeX E3 ubiquitin ligase 1)

Aliases

None

Description

BAL-associated protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_000313079

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03317.13.9987282255476324e-176hypothetical protein (323 aa)
OxytrichaContig10839.0.g251.9997255150861791e-53Ring finger domain
Stentor CoeruleusSteCoe_142714.780892883885469e-25

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000313079(coding)
ATGGAATAAATTCCTTAATAACCCAAGAATGAAAATAGCGAAGAAGTTTTAAAAGATGGT
GTTGAGTGGGTGAGAACTAATCATTGTAAAATAACCACATATTTTGATGCAAATGTCACG
ATTTTTGAAAATCATGGTAGAAAATATTAGTTAGATATGAAAAAAGATTTTATAAAAGAC
AATTAGGCAATTTAAAGTATTTTCGACTAATTGGGTGAGTTAGTTGATATTCTAGATAAA
AAGGATTAAAATATTGATGAAAAATTTGCAAGCATAATTAAATATAACAATTTTTCATCT
TTAGAATATCTTTTTATGAAGGTTCTTGATGATTTAGAAAAAAAAGAAAAAAATATTTCG
CATTAAGAAGATGAATAATGTTGTATCTGCTAATGCGATTTATATGATGACGTATATAAA
ATGACTTAAAGCGATTTTAAAAATTAAATTTAAAATAATTCTGACGAGGATGCTATCTAG
CTTTAAGACTGTGATGGACATTTTTTCCATTTCGGATGTATAAAACACATGCTTAAAGAC
TCTTATATTAAATGTCCTGTCTGCTCCAAAATATATGGTATTATGAAAGGTGATTAACCA
GATGGAAAGATGACTACTTATATTGATAAAAATTATAAATGCGCTGGTTTTAACTGCTCA
ACAATAGTAATTGATTATTAGATATACGGCAGTGTAAGAAACGGGAGACAAATACCTGGA
ACTCATAGAACTGCTTATCTACCTGATAATCAAGAAGGAAGAGAAGTGTTAAAGCTATTA
TAAATAGCATTTGATAGAAAACTTATTTTCACTGTAGGAAGGAGTGTTACTACTGGATAA
GATAATGTAGTTGTATGGAATGGTGTTCACCATAAAACTAGCCCTACAGGAGGTGCAGCT
TATTTTGGATACCCAGACCCAACTTATTTCAACAGAGTTAAATAAGAACTTGCTTTAAAA
GGTGTTAGATGA


>TTHERM_000313079(protein)
MEQIPQQPKNENSEEVLKDGVEWVRTNHCKITTYFDANVTIFENHGRKYQLDMKKDFIKD
NQAIQSIFDQLGELVDILDKKDQNIDEKFASIIKYNNFSSLEYLFMKVLDDLEKKEKNIS
HQEDEQCCICQCDLYDDVYKMTQSDFKNQIQNNSDEDAIQLQDCDGHFFHFGCIKHMLKD
SYIKCPVCSKIYGIMKGDQPDGKMTTYIDKNYKCAGFNCSTIVIDYQIYGSVRNGRQIPG
THRTAYLPDNQEGREVLKLLQIAFDRKLIFTVGRSVTTGQDNVVVWNGVHHKTSPTGGAA
YFGYPDPTYFNRVKQELALKGVR


>TTHERM_000313079(gene)
ATGGAATAAATTCCTTAATAACCCAAGAATGAAAATAGCGAAGAAGTTTTAAAAGATGGT
GTTGAGTGGGTGAGAACTAATCATTGTAAAATAACCACATATTTTGATGCAAATGTCACG
ATTTTTGAAAATCATGGTAGAAAATATTAGTTAGATATGAAAAAAGATTTTATAAAAGAC
AATTAGGCAATTTAAAGTATTTTCGACTAATTGGGTGAGTTAGTTGATATTCTAGATAAA
AAGGATTAAAATATTGATGAAAAATTTGCAAGCATAATTAAATATAACAATTTTTCATCT
TTAGAATATCTTTTTATGAAGGTTCTTGATGATTTAGAAAAAAAAGAAAAAAATATTTCG
CATTAAGAAGATGAATAATGTTGTATCTGCTAATGCGATTTATATGATGACGTATATAAA
ATGACTTAAAGCGATTTTAAAAATTAAATTTAAAATAATTCTGACGAGGATGCTATCTAG
CTTTAAGACTGTGATGGACATTTTTTCCATTTCGGATGTATAAAACACATGCTTAAAGAC
TCTTATATTAAATGTCCTGTCTGCTCCAAAATATATGGTATTATGAAAGGTAATTAAATA
TTTTTTGATGATTCTTGATTTTTATCAATTAATTTGTTTTATCATATATTAATATTCTAA
CTCAAATAATTTATCAATCAATTTATTCGCTTATTTATTATTTAATTTTTCTTATACTCA
ATCACCAAATCATATCTTTCTACTTAAAATCCAATAAATCTATGAATACTAAATACATTA
AAATAATAATTATTTATTTTATTAAAGGTGATTAACCAGATGGAAAGATGACTACTTATA
TTGATAAAAATTATAAATGCGCTGGTTTTAACTGCTCAACAATAGTAATTGATTATTAGA
TATACGGCAGTGTAAGAAACGGGAGACAAATACCTGGAACTCATAGAACTGCTTATCTAC
CTGATAATCAAGAAGGAAGAGAAGTGTTAAAGCTATTATAAATAGCATTTGATAGAAAAC
TTATTTTCACTGTAGGAAGGAGTGTTACTACTGGATAAGATAATGTAGTTGTATGGAATG
GTGTTCACCATAAAACTAGCCCTACAGGAGGTAAATTTATTTATTTTATTTTTTAGATTT
ATATTTATACAAAATTAATTTAACAGGTGCAGCTTATTTTGGATACCCAGACCCAACTTA
TTTCAACAGAGTTAAATAAGAACTTGCTTTAAAAGGTGTTAGATGA