Identifiers and Description

Gene Model Identifier

TTHERM_00335970

Standard Name

DTU1 (Delta-TUbulin 1)

Aliases

PreTt06040 | 34.m00277 | 3689.m00074

Description

Delta-tubulin protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00091 ) Tubulin/FtsZ family, GTPase domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00335970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16094.19.997093137033517e-262tubulin/FtsZ family, GTPase do
main-containing protein (443 a
a)
OxytrichaContig11849.0.g535.999266750653237e-78Tubulin/FtsZ family, GTPase do
main
SGDYLR212C1.999981404597394e-31TUB4 Gamma-tubulin, involved i
n nucleating microtubules from
both the cytoplasmic and nucl
ear faces of the spindle pole
body
DictyBaseDDB_G02818891.000382677035467e-28tubA2 on chromosome: 3 positio
n 5074777 to 5076633
WormBaseWBGene000031711.9993007828132465e-27locus:mec-7 Tubulin beta-1 c
hain status:Confirmed UniP
rot:P12456 protein_id:CCD675
58.1
Stentor CoeruleusSteCoe_168962.8625185805493937e-20

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00335970(coding)
ATGTCGATAGTATGTGTACAATTAGGATAGTGTGGCAATTAACTTGGTAATTCTTTTTAT
GATTTCCTAATAAATGAATGCTAAAATTCATCTCCTGCTGCATAAGCAACACTTTTAGAC
ACATTTTTTTACTAGAAAGAAGAAAAATCAGGTGTTAAAAATTATGCTAAATCACTTTTA
ATTGATATGGAACCTAAGGTTGTATAATCTTGTTTGAATTCTCATTAAAATGATGTTTGG
GAATTTGATCCTACAAATTGTTTTACATAGTAGGAAGGTTCTGGTAATAATTGGGCTTAT
GGTTATAATGTACATGGATTAAAATGTAGAGATAAAATTCTATAAACTTTTTAAAAATTG
CTAGAATAAATTGACTTTTGTGAAGGAATATTTTTATTATAATCTTTGGCTGGAGGTACT
GGAAGTGGATTAGGGTCGTTTATACTTGAAATGATAAATGATGAATACCCTGAGTTAAAT
AAAATGAATGTATGTGTTGCTCCACATTTGACAGGAGAAGTTATACTCTAAAGTTATAAT
TGTGTCCTTACAATAACAAGCTTATATTAAAATACAGATGGGATTATTTTAGTTGAGAAT
GATAAGATTGAAGAAATATGCAATAAGCTGCTCAATCTTAAAAGACCTTCTTTAAATGAA
ATGAATAGAGTTATTGCTCATCAGCTTTCTTCTGTACTCTTTCCTGTACTACCAGAGTCT
CAAAAAAACTCATCTGGTTAGTAATAACAAGTTAATTACTTTTCTAGCCTCCAAAATAAC
TTTAGATATTTTAATGATATTTATGATTTGTTACTAACAGATCCAAGATATAAAATTTTG
AGTATAAGAAATGTTCCACAAATGCCTGATGCTAGTAAAAGTTTTTAAAATGATTAGTGG
TCTGCTTTAGAAAAAAGGATATTTTAAATGTAAATAAGTAATAGTATGGAAAGTAATATT
AATTGGAGTAAAAAGATAGATTCTGGTATTAGGAGTTTAGGAAATATACTAATTGGGAGA
GGGATAGATGTTTAAAAATAAAAGTTTGAAATGTTTGCAGAGCCCTTAATTTATAAGAAT
TAGAGGGTAAATTATAGGTACTATAAAGATTCACATCAATTCAATAACAATGAAAAGAGT
ATATCGATGATTTCTAATTCGTAATTTTGTGTAGAGCCACTTTAAACTATTTCCAATAGA
GCTCATTAAATGTATAGAGAAAAAGCATATTTATATTAATATGAAAAATATGGCATCTCT
CAAGAAGAATTTTTTTAGAGTCTTGCTATTTTTGATTAGATTCTATTCAACTATCAATCT
ATTTGA


>TTHERM_00335970(protein)
MSIVCVQLGQCGNQLGNSFYDFLINECQNSSPAAQATLLDTFFYQKEEKSGVKNYAKSLL
IDMEPKVVQSCLNSHQNDVWEFDPTNCFTQQEGSGNNWAYGYNVHGLKCRDKILQTFQKL
LEQIDFCEGIFLLQSLAGGTGSGLGSFILEMINDEYPELNKMNVCVAPHLTGEVILQSYN
CVLTITSLYQNTDGIILVENDKIEEICNKLLNLKRPSLNEMNRVIAHQLSSVLFPVLPES
QKNSSGQQQQVNYFSSLQNNFRYFNDIYDLLLTDPRYKILSIRNVPQMPDASKSFQNDQW
SALEKRIFQMQISNSMESNINWSKKIDSGIRSLGNILIGRGIDVQKQKFEMFAEPLIYKN
QRVNYRYYKDSHQFNNNEKSISMISNSQFCVEPLQTISNRAHQMYREKAYLYQYEKYGIS
QEEFFQSLAIFDQILFNYQSI


>TTHERM_00335970(gene)
ATGTCGATAGTATGTGTACAATTAGGATAGTGTGGCAATTAACTTGGTAATTCTTTTTAT
GATTTCCTAATAAATGAATGCTAAAATTCATCTCCTGCTGCATAAGCAACACTTTTAGAC
ACATTTTTTTACTAGAAAGAAGAAAAATCAGGTGTTAAAAATTATGCTAAATCACTTTTA
ATTGATATGGAACCTAAGGTAAATATCATCTTTTTCTTATAATCAAAAGCATTAAAATCC
CTTGCTAAAAAAATATAAACAATTTAAAAATAACAAAATATTATTTATTACATTATACAT
TTTTTATAAACACATTTCGACTCAAAAATATGATTGAATTTATTTTTTAAAAAGAATTTA
TATTAGACTAAATTTGCTTTTTAATTTTAAGGTTGTATAATCTTGTTTGAATTCTCATTA
AAATGATGTTTGGGAATTTGATCCTACAAATTGTTTTACATAGTAGGAAGGTTCTGGTAA
TAATTGGGCTTATGGTTATAATGTACATGGATTAAAATGTAGAGATAAAATTCTATAAAC
TTTTTAAAAATTGCTAGAATAAATTGACTTTTGTGAAGGAATATTTTTATTATAATCTTT
GGCTGGAGGTACTGGAAGTGGATTAGGGTCGTTTATACTTGAAATGATAAATGATGAATA
CCCTGAGTTAAATAAAATGAATGTATGTGTTGCTCCACATTTGACAGGAGAAGTTATACT
CTAAAGTTATAATTGTGTCCTTACAATAACAAGCTTATATTAAAATACAGATGGGATTAT
TTTAGTTGAGAATGATAAGATTGAAGAAATATGCAATAAGCTGCTCAATCTTAAAAGACC
TTCTTTAAATGAAATGAATAGAGTAATAATAAATATCATTAAAATTTAGAATATTTTGGT
AAATATTTTTTTGTGTGTAATAGGTTATTGCTCATCAGCTTTCTTCTGTACTCTTTCCTG
TACTACCAGAGTCTCAAAAAAACTCATCTGGTTAGTAATAACAAGTTAATTACTTTTCTA
GCCTCCAAAATAACTTTAGATATTTTAATGATATTTATGATTTGTTACTAACAGATCCAA
GATATAAAATTTTGAGTATAAGAAATGTTCCACAAATGCCTGATGCTAGTAAAAGTTTTT
AAAATGATTAGTGGTCTGCTTTAGAAAAAAGGATATTTTAAATGTAAATAAGTAATAGTA
TGGAAAGTAATATTAATTGGAGTAAAAAGATAGATTCTGGTATTAGGAGTTTAGGAAATA
TACTAATTGGGAGAGGGATAGATGTTTAAAAATAAAAGTTTGAAATGTTTGCAGAGCCCT
TAATTTATAAGAATTAGAGGGTAAATTATAGGTACTATAAAGATTCACATCAATTCAATA
ACAATGAAAAGAGTATATCGATGATTTCTAATTCGTAATTTTGTGTAGAGCCACTTTAAA
CTATTTCCAATAGAGCTCATTAAATGTATAGAGAAAAAGCATATTTATATTAATATGAAA
AATATGGCATCTCTCAAGAAGAATTTTTTTAGAGTCTTGCTATTTTTGATTAGATTCTAT
TCAACTATCAATCTATTTGA