Identifiers and Description

Gene Model Identifier

TTHERM_00312120

Standard Name

DTS1 (Dihydrofolate reductase-Thymidylate Synthase 1)

Aliases

PreTt03400 | 30.m00209 | 3810.m01825

Description

Bifunctional dihydrofolate reductase-thymidylate synthase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00312120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03227.19.997093137033517e-262bifunctional dihydrofolate red
uctase-thymidylate synthase (4
86 aa)
OxytrichaContig20294.0.g96.000727524697947e-169Thymidylate synthase
WormBaseWBGene000224559.998919090800975e-129Thymidylate synthase status:
Confirmed UniProt:Q9N588 p
rotein_id:CCD66193.1
SGDYOR074C2.9990837046884738e-127CDC21 Thymidylate synthase, re
quired for de novo biosynthesi
s of pyrimidine deoxyribonucle
otides; expression is induced
at G1/S
Stentor CoeruleusSteCoe_178043.665820411179563e-77

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00312120(coding)
ATGAAAACAAGACATTTTGATATAGTTTTAGCTTAGACTTTAAAAAAATAGGGTATAGGT
TATAAGAACAGTTTACCATGGAGACTACCTAATGAGCTTAAAAACTTTAAAAAAATAACT
ACAGAAACTAAGAACAAAGGCCTATAAAACGCTGTTATCATGGGTAAAAATACTTGGGAA
GCACTACCTAAAAAGCAATAACCATTGAAAGATCGCTTAAATATTGTTATTTCCACTACT
ATGCAAGAGGGGTAAATTGCAGATCATTCCTACGCCTGTAAAAGCTTAGATTCTGCTTTA
AACTTTTTAGAATAGTAAAATTAAATATAAGATGCCCTTGTAATTGGAGGAGCTAAACTT
TGCCAATAAGCATTAAGCGATCAGAGACTTAGATAGATTCATCTAACAAGAGTAGGTGTC
GAAGTTGAGTGCGATGTTTTTATGCAAAAGGACTACTTAAAAAACTTTGATATGATTGAG
GTGTCTGAAACTTAAAGCGAAAATAATTTAAATTATGATTTTACTAGGTATTTTAATAAG
AATTATAAAGGATAAGTTGACCCTTCTCTCTTTAAGAAAATGTACAAGCCTCATCAAGAA
TATTAATACTTAGAACTTATCGATGAAATTATAAAGAATGGACATGTTAAAACAGACAGA
ACTGGAACTGGTACAATTTCTCAGTTTGGCAAGTTGATGAGATTTGACTTATCAAAGAGT
TTTCCTCTGCTTACTACCAAAAATGTTTTTTGGAGAGGTGTAGTAGAAGAACTTATTTGG
TTTATCAAAGGCAGTACAAACAGCAAAATACTTTCAGAAAAAGGAGTTAAAATATGGGAC
GGTAATGGCAGCAGAGAATTTTTAGATTAATTAGGCTTTAAAAACAGAGAAGAAGGAGAT
TTAGGTCCTGTTTATGGTTTCTAATGGAGACACTTCGGTGCTGAATATAAAGATATGCAT
ACAAATTATAAAGGTAAAGGTGTCGACCAGCTTCAAGATTTAATTAACACAATAAAGAAA
AATCCTGACAGCAGAAGGATGATTATGAATGCCTGGAATGTTAAAGATCTACCATTGATG
GCTTTACCTCCTTGTCATGTCATGAGCTAGTTTTATGTAAATGATAATAAACTAAGCTGT
ATGATGTACTAAAGATCTTGTGATATGGGTTTAGGAATACCATTTAATATAGCCAGTTAT
GCTTTATTGACTCATATGATAGCTTAAGTCACTAATATGTAAGTTGGAGAGTTTATACAT
GTTCTAGGTGATGCTCATGTTTACTCTAATCACGTAGATTAACTAAAAATTTAATTAGAA
AGAGCTCCATACCCCTTCCCTCTTTTAAAAATTAATAACAACAAGTAATATAACTCTATT
GAAGACTTCACTCTTGAAGATTTCGAATTAATTGGATACAACTATCACCCTAAAATATAA
ATGAAAATGGCTGTCTGA


>TTHERM_00312120(protein)
MKTRHFDIVLAQTLKKQGIGYKNSLPWRLPNELKNFKKITTETKNKGLQNAVIMGKNTWE
ALPKKQQPLKDRLNIVISTTMQEGQIADHSYACKSLDSALNFLEQQNQIQDALVIGGAKL
CQQALSDQRLRQIHLTRVGVEVECDVFMQKDYLKNFDMIEVSETQSENNLNYDFTRYFNK
NYKGQVDPSLFKKMYKPHQEYQYLELIDEIIKNGHVKTDRTGTGTISQFGKLMRFDLSKS
FPLLTTKNVFWRGVVEELIWFIKGSTNSKILSEKGVKIWDGNGSREFLDQLGFKNREEGD
LGPVYGFQWRHFGAEYKDMHTNYKGKGVDQLQDLINTIKKNPDSRRMIMNAWNVKDLPLM
ALPPCHVMSQFYVNDNKLSCMMYQRSCDMGLGIPFNIASYALLTHMIAQVTNMQVGEFIH
VLGDAHVYSNHVDQLKIQLERAPYPFPLLKINNNKQYNSIEDFTLEDFELIGYNYHPKIQ
MKMAV


>TTHERM_00312120(gene)
ATGAAAACAAGACATTTTGATATAGTTTTAGCTTAGACTTTAAAAAAATAGGGTATAGGT
TATAAGAACAGTTTACCATGGAGACTACCTAATGAGCTTAAAAACTTTAAAAAAATAACT
ACAGAAACTAAGAACAAAGGCCTATAAAACGCTGTTATCATGGGTAAAAATACTTGGGAA
GCACTACCTAAAAAGCAATAACCATTGAAAGATCGCTTAAATATTGTTATTTCCACTACT
ATGCAAGAGGGGTAAATTGCAGATCATTCCTACGCCTGTAAAAGCTTAGATTCTGCTTTA
AACTTTTTAGAATAGTAAAATTAAATATAAGATGCCCTTGTAATTGGAGGAGCTAAACTT
TGCCAATAAGCATTAAGCGATCAGAGACTTAGATAGATTCATCTAACAAGAGTAGGTCAG
TAGAATTAAATTTATTAAATACTTTCTTTTTATGAACAAAAGAGATAATTAAATAACTTT
TCAAAAATATTTAGGTGTCGAAGTTGAGTGCGATGTTTTTATGCAAAAGGACTACTTAAA
AAACTTTGATATGATTGAGGTGTCTGAAACTTAAAGCGAAAATAATTTAAATTATGATTT
TACTAGGTATTTTAATAAGAATTATAAAGGATAAGTTGACCCTTCTCTCTTTAAGAAAAT
GTACAAGCCTCATCAAGAATATTAATACTTAGAACTTATCGATGAAATTATAAAGAATGG
ACATGTTAAAACAGACAGAACTGGAACTGGTACAATTTCTCAGTTTGGCAAGTTGATGAG
ATTTGACTTATCAAAGAGTTTTCCTCTGCTTACTACCAAAAATGTTTTTTGGAGAGGTGT
AGTAGAAGTAATAAATATATTTATTTATTTATTAATTTATAGTTTGATAGATTTAAAAAT
GAAATTTAGTCTGATTTTTAGTAGAATAAATAAAATAATCTAAATATATAAATTAATAGG
AACTTATTTGGTTTATCAAAGGCAGTACAAACAGCAAAATACTTTCAGAAAAAGGAGTTA
AAATATGGGACGGTAATGGCAGCAGAGAATTTTTAGATTAATTAGGCTTTAAAAACAGAG
AAGAAGGAGATTTAGGTCCTGTTTATGGTTTCTAATGGAGACACTTCGGTGCTGAATATA
AAGATATGCATACAAATTATAAAGGTAAAGGTGTCGACCAGCTTCAAGATTTAATTAACA
CAATAAAGAAAAATCCTGACAGCAGAAGGATGATTATGAATGCCTGGAATGTTAAAGATC
TACCATTGATGGCTTTACCTCCTTGTCATGTCATGAGCTAGTTTTATGTAAATGATAATA
AACTAAGCTGTATGATGTACTAAAGATCTTGTGATATGGGTTTAGGAATACCATTTAATA
TAGCCAGTTATGCTTTATTGACTCATATGATAGCTTAAGTCACTAATATGTAAGTTGGAG
AGTTTATACATGTTCTAGGTGATGCTCATGTTTACTCTAATCACGTAGATTAACTAAAAA
TTTAATTAGAAAGAGCTCCATACCCCTTCCCTCTTTTAAAAATTAATAACAACAAGTAAT
ATAACTCTATTGAAGACTTCACTCTTGAAGATTTCGAATTAATTGGATACAACTATCACC
CTAAAATATAAATGAAAATGGCTGTCTGA