Identifiers and Description

Gene Model Identifier

TTHERM_00624310

Standard Name

DTD1 (D-Tyr-tRNA(Tyr) deacylase 1)

Aliases

PreTt07419 | 87.m00199 | 3814.m00902

Description

D-tyrosyl-tRNA(Tyr) deacylase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.5%

TetraMine Data

TTHERM_00624310

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12013.16.000220702367707e-121D-tyrosyl-tRNA(Tyr) deacylase
(353 aa)
OxytrichaContig14211.0.g461.9991939848149086e-44D-Tyr-tRNA(Tyr) deacylase
WormBaseWBGene000041513.000619078166531e-39locus:pqn-68 D-tyrosyl-tRNA(
Tyr) deacylase status:Confir
med UniProt:Q9XUP4 protein
_id:CAB04731.1
DictyBaseDDB_G02912736.99868990988981e-32dtd on chromosome: 6 position
40029 to 40659
SGDYDL219W4.9988726541653934e-26DTD1 D-Tyr-tRNA(Tyr) deacylase
, functions in protein transla
tion, may affect nonsense supp
ression via alteration of the
protein synthesis machinery; u
biquitous among eukaryotes
Stentor CoeruleusSteCoe_91442.3195228302435696e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00624310(coding)
ATGAGACTCATCATTTAAAGAGTTTTAGAAGCAGGAGTTAAAGTTAATGGCGAATTCATC
TCCAAAATAGGTCCAGGAATTTGTATTTTGTTAGGTTTACATAGAGGTGATAATGCTGAG
TTAGTTGATAAATGGGCTGAAAAAGCTTTGAAATTAAAATTATGGCCTGATATGGAAAAT
TAATCTGAAGAACAAAAAGAGAGCAACAATCCTAAGGGAAAAGGAGGTTGGAAGACAGGT
GTATAAGATAACAATTATGAAGTTTTGGTTGTTTCTAACTTTACTTTATATGGAGTTTTG
AAAGGAAATAAGCCTGATTTTCATGATTCTATGAATGCAGATGAAGCTAGGGACCTTTAC
AATAGATTTATGGAGAAGATGTAGTAACATTACAAAAAAGAAAAAGTTCAAGGAGGATAA
TTTTAGACATATATGAATGTTCATATTGTTAATGATGGACCTGTCACTTTATGTATTGAT
GCTGATGAAGTTAATAACATGAAACAAAACTAATAAAAACAAAAAGAAACATAATAGTAA
AATGAGAAAATAAATAGCGAAGGCAATAAAGTTGAAGGTGAAATAAAGGAAAAGTAAGAA
AAAAAATAAAAGAATAACTCTGAATAAAAGAATAAATAGCATGGAGGAGAAAAATAACAA
AAACCTCAAGGAGAAAATAAGTAAAACGCTTAAGGAGAACATAAGCAAAAAAATTAGGGA
GAAAACAAATAGAAGCAACAAGGAGAATAAAAGTAAAAAAATTAATAGAATGACCAAAAA
CAAAAACCCTAAGCTGAACAAAAATAGAAAGCTTAGTAAACTGAGATTGCTTAAAAAAAA
TAAAAGCCAATTTATGAAGAAAAAGTTGATGATAATTCTGCAAAAGTAGAATAAAAGGAC
GCTTAAGAAAACTAATAATAAGAATGA


>TTHERM_00624310(protein)
MRLIIQRVLEAGVKVNGEFISKIGPGICILLGLHRGDNAELVDKWAEKALKLKLWPDMEN
QSEEQKESNNPKGKGGWKTGVQDNNYEVLVVSNFTLYGVLKGNKPDFHDSMNADEARDLY
NRFMEKMQQHYKKEKVQGGQFQTYMNVHIVNDGPVTLCIDADEVNNMKQNQQKQKETQQQ
NEKINSEGNKVEGEIKEKQEKKQKNNSEQKNKQHGGEKQQKPQGENKQNAQGEHKQKNQG
ENKQKQQGEQKQKNQQNDQKQKPQAEQKQKAQQTEIAQKKQKPIYEEKVDDNSAKVEQKD
AQENQQQE


>TTHERM_00624310(gene)
AAAAAAGAAAAAATAAAGTTGATTCTAGACTCATAATTAAATAATTAATAAAAAAAATAA
ATTTTTTAATCAAAAACTATAAATTTTTACAGATATTCATTTTTAAAATCTATGAGACTC
ATCATTTAAAGAGTTTTAGAAGCAGGAGTTAAAGTTAATGGCGAATTCATCTCCAAAATA
GGTCCAGGAATTTGTATTTTGTTAGGTTTACATAGAGGTGATAATGCTGAGTTAGTTGAT
AAATGGGCTGAAAAAGCTTTGAAATTAAAATTATGGCCTGATATGGAAAATTAATCTGAA
GAACAAAAAGAGAGCAACAATCCTAAGGGAAAAGGAGGTTGGAAGACAGGTGTATAAGAT
AACAATTATGAAGTTTTGGTTGTTTCTAACTTTACTTTATATGGAGTTTTGAAAGGAAAT
AAGCCTGATTTTCATGATTCTATGAATGCAGATGAAGCTAGGGACCTTTACAATAGATTT
ATGGAGAAGATGTAGTAACATTACAAAAAAGAAAAAGTTCAAGGAGGATAATTTTAGACA
TATATGAATGTTCATATTGTTAATGATGGACCTGTCACTTTATGTATTGATGCTGATGAA
GTTAATAACATGAAACAAAACTAATAAAAACAAAAAGAAACATAATAGTAAAATGAGAAA
ATAAATAGCGAAGGCAATAAAGTTGAAGGTGAAATAAAGGAAAAGTAAGAAAAAAAATAA
AAGAATAACTCTGAATAAAAGAATAAATAGCATGGAGGAGAAAAATAACAAAAACCTCAA
GGAGAAAATAAGTAAAACGCTTAAGGAGAACATAAGCAAAAAAATTAGGGAGAAAACAAA
TAGAAGCAACAAGGAGAATAAAAGTAAAAAAATTAATAGAATGACCAAAAACAAAAACCC
TAAGCTGAACAAAAATAGAAAGCTTAGTAAACTGAGATTGCTTAAAAAAAATAAAAGCCA
ATTTATGAAGAAAAAGTTGATGATAATTCTGCAAAAGTAGAATAAAAGGACGCTTAAGAA
AACTAATAATAAGAATGA