Identifiers and Description

Gene Model Identifier

TTHERM_00835350

Standard Name

DSK2 (DSK2 ortholog)

Aliases

PreTt24550 | 145.m00117

Description

Ubiquitin family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00835350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16807.14.999878681532552e-93ubiquitin family protein (561
aa)
SGDYMR276W7.002785992501305e-33DSK2 Nuclear-enriched ubiquiti
n-like polyubiquitin-binding p
rotein, required for spindle p
ole body (SPB) duplication and
for transit through the G2/M
phase of the cell cycle, invol
ved in proteolysis, interacts
with the proteasome
WormBaseWBGene000088522.000769134519826e-18locus:ubql-1 status:Confirme
d UniProt:G5EFF7 protein_i
d:CAA95799.1
DictyBaseDDB_G02674526.001122775063233e-17sonA on chromosome: 1 position
1168646 to 1170444
OxytrichaContig457.0.g180.00003998524687536623Ubiquitin family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00835350(coding)
ATGGAAGGAGAAATTATTGTAAAACTAAAACTTTCCAATGAAGGAACCTTTGAAATTAAG
ATTGACCCTAAGGCCACTGTTTTGTAGTTTAAGGAAAAGATTGCTAAGGAAAAGAATTGC
GAAACTGGTCACATTAAGCTGATTTACAAAGGAAAATGGTTGAAGAATGATGAAGAAACT
TTGGAACATAACAAAGTTATTGATGGAAACACAATGCACATTATCATTAATAAGCCTAAT
GAAGCTGATAATAGCAACACCACTAATGCTTAAACCAGTTCTACAACTAATACAACCTCT
TCATCTACTTCAAGTCAAGTTCCTAACAACTTGAATGCTGGTTAAGGTTAAAATCCCTTT
GCCTCTTTGGGAGGTTTAGGAGGACTTGGTGGACTTGGCGGTCTTGGTGGTCTCGGAGGT
TTGGGAGCTAATGGTTAACTTGACCCTAATGACCTTGCCTAAGCTATGCAATCTCCTTAA
GTACAATAAATGATGTAATAGATGCTTTCCAACCCATAAGCTCTCCAACAAATGCTCCAA
TAGAATCCTTACACCAGATAAATGCTTGAACAAAATCCTCAACTCTTATAAATGCTTTCT
GACCCCATGATGATTTAAATGATTAGTAACCCTTAATTCTTACAAAATGCCATGCAAATG
ATGGGTAATAATGGTGGCATGGGTGGCATGGGAGGCCTTGGTGGTCTAGGAGGACTTGGC
GGATTAGGAGGACTCGGTGGTTTAGGTGCTTTTGGTTAACAATAACCTTAATAATAGGCA
TAATAATAAGCATAATAATAGGGATAATAAGGAACTTAATAAACAGGATAATAATAATAA
TAGTAACCTGGTTAATTACCTCCTTTCAATTTTGCTCAATTGTTAAACAATCCTTTATTC
GGAGGAATGGGTGGTATGGGCGGCTTAGGAGGTTTCGGATTCCCTCCTGCTCAATAAGAC
AACACCCCTCCTGAAGAAAAATATAAGGAATAGTTAGCTCAATTAGAAGTTATGGGTTTT
ACTAACAAATAAGTTAACCTTGAAGCTCTTAAGGCTACAGGTGGTAACGTTGAAGCTGCT
ATTGAACGTATTTTAAACATGCTTGGTTGA


>TTHERM_00835350(protein)
MEGEIIVKLKLSNEGTFEIKIDPKATVLQFKEKIAKEKNCETGHIKLIYKGKWLKNDEET
LEHNKVIDGNTMHIIINKPNEADNSNTTNAQTSSTTNTTSSSTSSQVPNNLNAGQGQNPF
ASLGGLGGLGGLGGLGGLGGLGANGQLDPNDLAQAMQSPQVQQMMQQMLSNPQALQQMLQ
QNPYTRQMLEQNPQLLQMLSDPMMIQMISNPQFLQNAMQMMGNNGGMGGMGGLGGLGGLG
GLGGLGGLGAFGQQQPQQQAQQQAQQQGQQGTQQTGQQQQQQPGQLPPFNFAQLLNNPLF
GGMGGMGGLGGFGFPPAQQDNTPPEEKYKEQLAQLEVMGFTNKQVNLEALKATGGNVEAA
IERILNMLG


>TTHERM_00835350(gene)
TTATTTATTTATATAGCTAAGCTATTTGAAGAAAATAAATAAATAAATAATAAAGAATTT
AAGTAAATTTTAAGTAAATTTAAAAAATTATCAAAACAACTCTCAAAAAAAACCAAAAAA
TAGAAAATGGAAGGAGAAATTATTGTAAAACTAAAACTTTCCAATGAAGGAACCTTTGAA
ATTAAGATTGACCCTAAGGCCACTGTTTTGTAGTTTAAGGAAAAGATTGCTAAGGAAAAG
AATTGCGAAACTGGTCACATTAAGCTGATTTACAAAGGTATAATTTTTAGATATTTTGTT
TTATTGTCCATGATTTTTTGCAATCAAGCAAAAAGATCAAACAGAGATAAGATTTTATAC
AGAATAACAAAATAAAGCTTATTTCTTTCGCAATTTACTTTTGAATAATTGACTTATTTT
GTTTTTATTAACCAAATTTATAGGAAAATGGTTGAAGAATGATGAAGAAACTTTGGAACA
TAACAAAGTTATTGATGGAAACACAATGCACATTATCATTAATAAGCGTAAGCAAGCATT
AATTAACAAAAGGTTTTCATAGCAAATATAAAATGTTCACTTAGCAAGCAAGACATTTTA
TATTACTTAAACTAAATATTTTTTAGAATTTTGAGCAATAATTTTATTTAAAAAATAATA
ATTAGCTAATGAAGCTGATAATAGCAACACCACTAATGCTTAAACCAGTTCTACAACTAA
TACAACCTCTTCATCTACTTCAAGTCAAGTTCCTAACAACTTGAATGCTGGTTAAGGTTA
AAATCCCTTTGCCTCTTTGGGAGGTTTAGGAGGACTTGGTGGACTTGGCGGTCTTGGTGG
TCTCGGAGGTTTGGGAGCTAATGGTTAACTTGACCCTAATGACCTTGCCTAAGCTATGCA
ATCTCCTTAAGTACAATAAATGATGTAATAGGTAATAAGCTTTTCATAATTTGACTTTTT
AAACACAAATACGCATGTTTTATAATGTTATTTATATCTAATTTTATTAACAAACAGATG
CTTTCCAACCCATAAGCTCTCCAACAAATGCTCCAATAGAATCCTTACACCAGATAAATG
CTTGAACAAAATCCTCAACTCTTAGTAAGAAATTTAACTCTTTAAATCAATAAATAAATA
AAACAAAGCAAAAAAGTTAGAAATGAGCAAAGAAATTAAAGAATAAAAAAACAAAAAAGT
AGATAAATAAATGAATGAATAATTAAATAAATGAAGTTTTCAATAAAATAATAAAAAAAG
GAATTAGCAGATAAAGATTTCAGAATATATTTAAAATATATTGAATTTTTAAAATCAATT
TATTTAATGGTTTTTATTAATTAATTATTTAGTAAATGCTTTCTGACCCCATGATGATTT
AAATGATTAGTAACCCTTAATTCTTACAAAATGCCATGCAAATGATGGGTAATAATGGTG
GCATGGGTGGCATGGGAGGCCTTGGTGGTCTAGGAGGACTTGGCGGATTAGGAGGACTCG
GTGGTTTAGGTGCTTTTGGTTAACAATAACCTTAATAATAGGCATAATAATAAGCATAAT
AATAGGGATAATAAGGAACTTAATAAACAGGATAATAATAATAATAGTAACCTGGTTAAT
TACCTCCTTTCAATTTTGCTCAATTGTTAAACAATCGTAAATTCAATATTTTTTTATCAC
ATTTTATTAAAATTGTTTTGAATTAATTAATAGCTTTATTCGGAGGAATGGGTGGTATGG
GCGGCTTAGGAGGTTTCGGATTCCCTCCTGCTCAATAAGACAACACCCCTCCTGAAGAAA
AATATAAGGAATAGTTAGCTCAATTAGAAGTTATGGGTTTTACTAACAAATAAGTTAACC
TTGAAGCTCTTAAGGCTACAGGTGGTAACGTTGAAGCTGCTATTGAACGTATTTTAAACA
TGCTTGGTTGA