Identifiers and Description

Gene Model Identifier

TTHERM_00592750

Standard Name

DRS2 (Aspartyl-tRNA synthetase 2)

Aliases

PreTt25028 | 82.m00118 | 3835.m00528

Description

DRS2 cytoplasmic aspartyl-tRNA synthetase; tRNA synthetases class II

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00592750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18334.15.001841681745041e-174aspartyl-tRNA synthetase (631
aa)
OxytrichaContig8290.0.g581.0001155149984988e-113tRNA synthetases class II (D,
K and N)
DictyBaseDDB_G02722369.997751616309157e-110aspS1 on chromosome: 2 positio
n 1722204 to 1724012
SGDYLL018C1.000434858898539e-105DPS1 Aspartyl-tRNA synthetase,
primarily cytoplasmic; homodi
meric enzyme that catalyzes th
e specific aspartylation of tR
NA(Asp); class II aminoacyl tR
NA synthetase; binding to its
own mRNA may confer autoregula
tion
WormBaseWBGene000010942.9996910481190226e-100locus:dars-1 Aspartate--tRNA
ligase, cytoplasmic status:
Confirmed UniProt:Q03577 p
rotein_id:CAA79536.1
Stentor CoeruleusSteCoe_271813.817497188671175e-54

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00592750(coding)
ATGGCTGAATGTTTATAAGAATCTGCTTAAAAAATATCAGAAGAAATATAAGAAAATAAA
TAGAATTTTGAAGAAAATTATTCTAATAATTAAAATTCAATAAAAATAAAATTAAAATAA
AATAAGTTAATAAAAATAAAAAATGAAGCTTTATAAAATGAAGAAAAGTGGGTTTAAGAG
CTCAATGACGATTCTCTTAAGGAAAATTATGGAGACTATTAACTTGTCTAGAGCTTATAA
TAAACAAACAAGAAATGGATTTAAGAAAGAATATCTTGA


>TTHERM_00592750(protein)
MAECLQESAQKISEEIQENKQNFEENYSNNQNSIKIKLKQNKLIKIKNEALQNEEKWVQE
LNDDSLKENYGDYQLVQSLQQTNKKWIQERIS


>TTHERM_00592750(gene)
ATGGCTGAATGTTTATAAGAATCTGCTTAAAAAATATCAGAAGAAATATAAGAAAATAAA
TAGAATTTTGAAGAAAATTATTCTAATAATTAAAATTCAATAAAAATAAAATTAAAATAA
AATAAGTTAATAAAAATAAAAAATGAAGCTTTATAAAATGAAGAAAAGTGGGTTTAAGAG
CTCAATGACGATTCTCTTAAGGAAAATTATGGAGACTATTAACTTGTCTAGAGCTTATAA
TAAACAAACAAGAAATGGATTTAAGTAACTCTACTCTTCATAATTATTTTTCATGATACA
ATTGATTTTTTTAGCAATAAAAAACTTTTAAAAATAAATGAAAATTTTTTAATAAACAAA
ACATATAGATTAAGGATATTGATGATTCTTTTTTAGGAAAGAATATCTTGATTAGAGGGA
GGTTGCATAATCTAAGGATTATTGGAAATTGTGCGTTTTTAATTGTAAGACAACAATCTT
AAAATATTTAAGTTGTTGCACAAAAGCAAGCTGATATAACTTCTAAAACTATGATTAAAT
GGATTAAAAAGATACACCTTGAGTCAATAATAGATATTCATGGAATAGTTTAAAAACCTA
ATATTCCTATCAATTGTGCTTCATCTTAATATGAAATTTGTTTGAAAAAAATATTTGTAG
TATCTAGGAGTAGTTCTCTTAATTATGGAGTAGCAGATATTTAAAGAATAAAAAAAAAAG
TTTAAAAGAAATTAGTGATGAAAATGAAGAAATAGATTTAGAAGATAGAAAAGCAATAAA
TAATTCGTTTTTATTTAATACCATCAATAAAGTTATTGATTTAAGAACCTCTGCTTAGCA
AGCTATATTCAGGCTGAAGTCAAGTATTTGCCAGATGTTTAGAGAAAATTTATTGCTTTA
AGGGTTTATAGAAATTCATACTCCTAAAATAATTTAGAGCTTTAAAAAAGAATATTCTGA
TAGCTTTTCTCTTGATTATTTTGGTATAGATGCTTAACTAAGTAATTTTCCAAAGTTTTA
TTCATAAATGGCTATTTAATCTGATTTTGAAAGAGTCTTTGAAATAGGTCCTATTTATAG
GAAACTTCATGGTAGAACTCATCACACTCTATGTGAATTTATTGGAATGAATCTTGAAAT
GGAAATCAAAGAAAGCTACTAAGAGGTTATTGATATCGTAACAGACTTACTTTTTAGTAT
ATTTTTAAGTTTAGAAATGATGTTTTAATAAGAGCTACAAATTGTTAAAGAATATTTTCC
TTCTTAAACGCTTAAAATAAAAAAACCTGTTCTGTAAATTTCATTTTAGGAAGCTTGTAG
TTTATTAGGTGAAGTCTAAAATTAGATGGATTATTTAGATAATATAAATTAAGTAAAATT
AAGTAAAATAATAAGTTAAAAGTATGATACAGATTTCTATATAATCACTCAATTTCCATC
TATTTCAAGTAATTTTATGGATATAGTTTGTGATGAAGAGCCTAATTATACATATTCTTA
CAAATTCTTTTTAAGAAACGGAGAAATAGCATCTGGATCACAAAGAAATCATGATCCTTT
ATCTTTAGAAAAAAGAGCTTTACAATATGGAATTGATATTAATTCAATAAAAAAATATAT
TGATGTAATTTCTTATGGTGCTTATCCGCATGGAGGCTGCTGTATTGGTTTGGAAAGATT
AATTTTGTATTACTTAGATTTATAGAACATAAGAAAAGCATCTTTATTTTCTCGAGATAG
CAAAACAATAAATCCATGAAAAAGTCAAACAAACAACAAAAGAAATTAAATTAATTTATA
TATTATTTTTTTTTTTGAATATTATAAATATGCTATTTTTATCTTTGGTAAATTCACCTT
AATAATTCGTATATAAGAATATATATTATATTTTCATATATGTATTAATTAAAGATTTAT
AATTATTTTTTGGTTATTAATATATTTTTATTAGTGGCTCAAAATTAATGAGTAATTAGA
GTATTTAGAAAAAAAATTTTAATTTAATAAAATGTTATGAAATATTAAAGATGTAGTATT
AGACTGAGCAAAATTAATAGATAATAAATATGTGA