Identifiers and Description

Gene Model Identifier

TTHERM_00592750

Standard Name

DRS2 (Aspartyl-tRNA synthetase 2)

Aliases

PreTt25028 | 82.m00118 | 3835.m00528

Description

tRNA synthetases class II

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00592750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18334.15.001841681745041e-174aspartyl-tRNA synthetase (631
aa)
OxytrichaContig8290.0.g581.0001155149984988e-113tRNA synthetases class II (D,
K and N)
DictyBaseDDB_G02722369.997751616309157e-110aspS1 on chromosome: 2 positio
n 1722204 to 1724012
SGDYLL018C1.000434858898539e-105DPS1 Aspartyl-tRNA synthetase,
primarily cytoplasmic; homodi
meric enzyme that catalyzes th
e specific aspartylation of tR
NA(Asp); class II aminoacyl tR
NA synthetase; binding to its
own mRNA may confer autoregula
tion
WormBaseWBGene000010942.9996910481190226e-100locus:dars-1 Aspartate--tRNA
ligase, cytoplasmic status:
Confirmed UniProt:Q03577 p
rotein_id:CAA79536.1
Stentor CoeruleusSteCoe_271813.817497188671175e-54

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00592750(coding)
ATGGCTGAATGTTTATAAGAATCTGCTTAAAAAATATCAGAAGAAATATAAGAAAATAAA
TAGAATTTTGAAGAAAATTATTCTAATAATTAAAATTCAATAAAAATAAAATTAAAATAA
AATAAGTTAATAAAAATAAAAAATGAAGCTTTATAAAATGAAGAAAAGTGGGTTTAAGAG
CTCAATGACGATTCTCTTAAGGAAAATTATGGAGACTATTAACTTGTCTAGAGCTTATAA
TAAACAAACAAGAAATGGATTTAAATTAAGGATATTGATGATTCTTTTTTAGGAAAGAAT
ATCTTGATTAGAGGGAGGTTGCATAATCTAAGGATTATTGGAAATTGTGCGTTTTTAATT
GTAAGACAACAATCTTAAAATATTTAAGTTGTTGCACAAAAGCAAGCTGATATAACTTCT
AAAACTATGATTAAATGGATTAAAAAGATACACCTTGAGTCAATAATAGATATTCATGGA
ATAGTTTAAAAACCTAATATTCCTATCAATTGTGCTTCATCTTAATATGAAATTTGTTTG
AAAAAAATATTTGTAGTATCTAGGAGTAGTTCTCTTAATTATGGAGTAGCAGATATTTAA
AGAATAAAAAAAAAAAGTTTAAAAGAAATTAGTGATGAAAATGAAGAAATAGATTTAGAA
GATAGAAAAGCAATAAATAATTCGTTTTTATTTAATACCATCAATAAAGTTATTGATTTA
AGAACCTCTGCTTAGCAAGCTATATTCAGGCTGAAGTCAAGTATTTGCCAGATGTTTAGA
GAAAATTTATTGCTTTAAGGGTTTATAGAAATTCATACTCCTAAAATAATTTAGAGCTTT
AAAAAAGAATATTCTGATAGCTTTTCTCTTGATTATTTTGGTATAGATGCTTAACTAAGT
AATTTTCCAAAGTTTTATTCATAAATGGCTATTTAATCTGATTTTGAAAGAGTCTTTGAA
ATAGGTCCTATTTATAGGAAACTTCATGGTAGAACTCATCACACTCTATGTGAATTTATT
GGAATGAATCTTGAAATGGAAATCAAAGAAAGCTACTAAGAGGTTATTGATATCGTAACA
GACTTACTTTTTAGTATATTTTTAAGTTTAGAAATGATGTTTTAATAAGAGCTACAAATT
GTTAAAGAATATTTTCCTTCTTAAACGCTTAAAATAAAAAAACCTGTTCTGTAAATTTCA
TTTTAGGAAGCTTGTAGTTTATTAGGTGAAGTCTAAAATTAGATGGATTATTTAGATAAT
ATAAATTAAGTAAAATTAAGTAAAATAATAAGTTAAAAGTATGATACAGATTTCTATATA
ATCACTCAATTTCCATCTATTTCAAGTAATTTTATGGATATAGTTTGTGATGAAGAGCCT
AATTATACATATTCTTACAAATTCTTTTTAAGAAACGGAGAAATAGCATCTGGATCACAA
AGAAATCATGATCCTTTATCTTTAGAAAAAAGAGCTTTACAATATGGAATTGATATTAAT
TCAATAAAAAAATATATTGATGTAATTTCTTATGGTGCTTATCCGCATGGAGGCTGCTGT
ATTGGTTTGGAAAGATTAATTTTGTATTACTTAGATTTATAGAACATAAGAAAAGCATCT
TTATTTTCTCGAGATAGCAAAACAATAAATCCATGA


>TTHERM_00592750(protein)
MAECLQESAQKISEEIQENKQNFEENYSNNQNSIKIKLKQNKLIKIKNEALQNEEKWVQE
LNDDSLKENYGDYQLVQSLQQTNKKWIQIKDIDDSFLGKNILIRGRLHNLRIIGNCAFLI
VRQQSQNIQVVAQKQADITSKTMIKWIKKIHLESIIDIHGIVQKPNIPINCASSQYEICL
KKIFVVSRSSSLNYGVADIQRIKKKSLKEISDENEEIDLEDRKAINNSFLFNTINKVIDL
RTSAQQAIFRLKSSICQMFRENLLLQGFIEIHTPKIIQSFKKEYSDSFSLDYFGIDAQLS
NFPKFYSQMAIQSDFERVFEIGPIYRKLHGRTHHTLCEFIGMNLEMEIKESYQEVIDIVT
DLLFSIFLSLEMMFQQELQIVKEYFPSQTLKIKKPVLQISFQEACSLLGEVQNQMDYLDN
INQVKLSKIISQKYDTDFYIITQFPSISSNFMDIVCDEEPNYTYSYKFFLRNGEIASGSQ
RNHDPLSLEKRALQYGIDINSIKKYIDVISYGAYPHGGCCIGLERLILYYLDLQNIRKAS
LFSRDSKTINP


>TTHERM_00592750(gene)
ATGGCTGAATGTTTATAAGAATCTGCTTAAAAAATATCAGAAGAAATATAAGAAAATAAA
TAGAATTTTGAAGAAAATTATTCTAATAATTAAAATTCAATAAAAATAAAATTAAAATAA
AATAAGTTAATAAAAATAAAAAATGAAGCTTTATAAAATGAAGAAAAGTGGGTTTAAGAG
CTCAATGACGATTCTCTTAAGGAAAATTATGGAGACTATTAACTTGTCTAGAGCTTATAA
TAAACAAACAAGAAATGGATTTAAGTAACTCTACTCTTCATAATTATTTTTCATGATACA
ATTGATTTTTTTAGCAATAAAAAACTTTTAAAAATAAATGAAAATTTTTTAATAAACAAA
ACATATAGATTAAGGATATTGATGATTCTTTTTTAGGAAAGAATATCTTGATTAGAGGGA
GGTTGCATAATCTAAGGATTATTGGAAATTGTGCGTTTTTAATTGTAAGACAACAATCTT
AAAATATTTAAGTTGTTGCACAAAAGCAAGCTGATATAACTTCTAAAACTATGATTAAAT
GGATTAAAAAGATACACCTTGAGTCAATAATAGATATTCATGGAATAGTTTAAAAACCTA
ATATTCCTATCAATTGTGCTTCATCTTAATATGAAATTTGTTTGAAAAAAATATTTGTAG
TATCTAGGAGTAGTTCTCTTAATTATGGAGTAGCAGATATTTAAAGAATAAAAAAAAAAA
GTTTAAAAGAAATTAGTGATGAAAATGAAGAAATAGATTTAGAAGATAGAAAAGCAATAA
ATAATTCGTTTTTATTTAATACCATCAATAAAGTTATTGATTTAAGAACCTCTGCTTAGC
AAGCTATATTCAGGCTGAAGTCAAGTATTTGCCAGATGTTTAGAGAAAATTTATTGCTTT
AAGGGTTTATAGAAATTCATACTCCTAAAATAATTTAGAGCTTTAAAAAAGAATATTCTG
ATAGCTTTTCTCTTGATTATTTTGGTATAGATGCTTAACTAAGTAATTTTCCAAAGTTTT
ATTCATAAATGGCTATTTAATCTGATTTTGAAAGAGTCTTTGAAATAGGTCCTATTTATA
GGAAACTTCATGGTAGAACTCATCACACTCTATGTGAATTTATTGGAATGAATCTTGAAA
TGGAAATCAAAGAAAGCTACTAAGAGGTTATTGATATCGTAACAGACTTACTTTTTAGTA
TATTTTTAAGTTTAGAAATGATGTTTTAATAAGAGCTACAAATTGTTAAAGAATATTTTC
CTTCTTAAACGCTTAAAATAAAAAAACCTGTTCTGTAAATTTCATTTTAGGAAGCTTGTA
GTTTATTAGGTGAAGTCTAAAATTAGATGGATTATTTAGATAATATAAATTAAGTAAAAT
TAAGTAAAATAATAAGTTAAAAGTATGATACAGATTTCTATATAATCACTCAATTTCCAT
CTATTTCAAGTAATTTTATGGATATAGTTTGTGATGAAGAGCCTAATTATACATATTCTT
ACAAATTCTTTTTAAGAAACGGAGAAATAGCATCTGGATCACAAAGAAATCATGATCCTT
TATCTTTAGAAAAAAGAGCTTTACAATATGGAATTGATATTAATTCAATAAAAAAATATA
TTGATGTAATTTCTTATGGTGCTTATCCGCATGGAGGCTGCTGTATTGGTTTGGAAAGAT
TAATTTTGTATTACTTAGATTTATAGAACATAAGAAAAGCATCTTTATTTTCTCGAGATA
GCAAAACAATAAATCCATGA