Identifiers and Description

Gene Model Identifier

TTHERM_00616050

Standard Name

DRS1 (Aspartyl-tRNA synthetase 1)

Aliases

PreTt19154 | 85.m00147 | 3725.m00038

Description

aspartyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00499 ) lysyl-tRNA synthetase
  • ( TIGR00458 ) aspartyl-tRNA synthetase
  • ( TIGR00459 ) aspartyl-tRNA synthetase
  • ( TIGR00457 ) asparaginyl-tRNA synthetase
  • ( PF01336 ) OB-fold nucleic acid binding domain
  • ( PF00152 ) tRNA synthetases class II (D,
  • ( TIGR00462 ) lysyl-tRNA synthetase-like protein GenX
  • ( PF00587 ) tRNA synthetase class II core

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00616050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_271810
Tetrahymena borealisEI9_18334.19.997093137033517e-262aspartyl-tRNA synthetase (631
aa)
OxytrichaContig8290.0.g589.997093137033517e-262tRNA synthetases class II (D,
K and N)
SGDYLL018C9.00303245425055e-177DPS1 Aspartyl-tRNA synthetase,
primarily cytoplasmic; homodi
meric enzyme that catalyzes th
e specific aspartylation of tR
NA(Asp); class II aminoacyl tR
NA synthetase; binding to its
own mRNA may confer autoregula
tion
DictyBaseDDB_G02722363.999622461503957e-161aspS1 on chromosome: 2 positio
n 1722204 to 1724012
WormBaseWBGene000010946.002643599093603e-161locus:dars-1 Aspartate--tRNA
ligase, cytoplasmic status:
Confirmed UniProt:Q03577 p
rotein_id:CAA79536.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00616050(coding)
ATGGCTGATAAAGTTGAAACCCCCGTTGTTGAAAAACAAGAAGAAACTGTCCCTGTTGAA
GGAGCTGCTAAGGAAGGTGGTGAAAATGCTTCTAAGAAAGCTCAAAAGAAGCTTGAAAAG
GAACAAGAAAAGGAAAGAAAGAGATTAGAAAGAGAAGCCGCCTAATTGAAGGAATAGGAG
GAAAATTGGCTTAAGGAACTCAAGGAAGATACTCTTAAGGAAAACTACGGAGATTATATC
CTTGTTCAAAGTCAAGAAAAGACTGACAGAAAGTGGATTTAGGTTTTGAGTATTGATGAA
TCAATGGTCGGTTAAACCGTCTTGATCAGAGCAAGACTCCAAAATTCTAGAGTTAAGGGT
AATGTCGGTTTCTTAGTTTTGAGATAACAATTTTCTACCATCCAAGCTATGATCTCTAAG
AACGACGTCACTGTTTCTAAGACCATGGTTAAATGGGTTGGTAAGGTTCCTTGTGAATCT
ATCGTTGATGTTTACGGTGTTGTCTCTAAGCCTGAAACTGAAATTAAGAGTACTTCATGC
AAACTTGAATTGATTGTCAACAAGGTTTATGTTGTCTCTCGTTCAAGAGCTCAACTTCCT
TTCCAATTAGAAGATGCTGCTAGATAATAAAAGAAGGAAGAACAATTAGCTGAATACAAT
AACAATGAAGGTGATATTGAAGAATCTAAGGATAATTAAGCCAGTGTCTCCATTAAAACT
CGTTTAGATAACAGAATTATTGATTTAAGAACTCCTGCCAAGCAAGCTATTTTCAGATTA
CAATCTGGTATCTGCCAATTATTCCGTGAATACTTACTTTCATAAGATTTCGTTGAAATT
CACACTCCTAAGCTTATTGGTGGTTCTTCTGAAGGTGGTGCTAACATCTTCAAGTTGAAG
TATTTCGATAAGGATGCTTGTCTTGCTTAATCTCCTTAACTCTACAAGTAAATGTGTATC
TAATCTGACTTCGAAAGAGTCTTCGAAATAGGTCCCGTTTTCAGAGCTGAAAAATCATTC
ACCCATCGTCACATGTGTGAATTCACTGGTTTGGATATTGAAATGTCCATTAAAGAAAAC
TACCATGAGCTTCTTGATCTTATGGGTGATTTATTCGTCCACATCTTCAAGGGCTTAGAA
ACCAAATACAGCAAGGAAATCGAAGCTATTTAATAATAATTCCCCTTCGAACCTTTCAAA
ATTAAAACCCCTGTTGTTAAACTCACTTTCGAAGAAGGTTGCAAACTCTTAAAAGAAGCT
GGTATTGAATAAAACCCCTTAGAAGATTTAGATACTGTTACTGAAAAGAAGCTTGGTGAC
ATCGTCCGTGAAAAGTATGATACTGATTTCTATATGCTCCATAGATATCCTATCTCTGCT
AGACCTTTCTACACCATGCTTTGCCACGATGATCCTAACTACACTCTTTCTTACGATTTC
TTCATGAGAGGTTAAGAAATCACCTCAGGTGCCTAAAGAAATCACGACCCCGTTTCTCTC
GCTAAGCGTGCTGCTGAATGTGGTATCAATGTAGAAACTATTAAAGATTATATTGAATCT
ATGGCTTTCGGTGCTTATCCTCATGGTGGTTGTGGTATTGGTCTTGAAAGAGTTGTTTTC
CTCTACTGCGACCTTTACGATATTAGAAACGGTTGCTTATTCCCCAGAGATCCTAAAAGA
ATTGCTCCTTGA


>TTHERM_00616050(protein)
MADKVETPVVEKQEETVPVEGAAKEGGENASKKAQKKLEKEQEKERKRLEREAAQLKEQE
ENWLKELKEDTLKENYGDYILVQSQEKTDRKWIQVLSIDESMVGQTVLIRARLQNSRVKG
NVGFLVLRQQFSTIQAMISKNDVTVSKTMVKWVGKVPCESIVDVYGVVSKPETEIKSTSC
KLELIVNKVYVVSRSRAQLPFQLEDAARQQKKEEQLAEYNNNEGDIEESKDNQASVSIKT
RLDNRIIDLRTPAKQAIFRLQSGICQLFREYLLSQDFVEIHTPKLIGGSSEGGANIFKLK
YFDKDACLAQSPQLYKQMCIQSDFERVFEIGPVFRAEKSFTHRHMCEFTGLDIEMSIKEN
YHELLDLMGDLFVHIFKGLETKYSKEIEAIQQQFPFEPFKIKTPVVKLTFEEGCKLLKEA
GIEQNPLEDLDTVTEKKLGDIVREKYDTDFYMLHRYPISARPFYTMLCHDDPNYTLSYDF
FMRGQEITSGAQRNHDPVSLAKRAAECGINVETIKDYIESMAFGAYPHGGCGIGLERVVF
LYCDLYDIRNGCLFPRDPKRIAP


>TTHERM_00616050(gene)
ATGGCTGATAAAGTTGAAACCCCCGTTGTTGAAAAACAAGAAGAAACTGTCCCTGTTGAA
GGAGCTGCTAAGGAAGGTGGTGAAAATGCTTCTAAGAAAGCTCAAAAGAAGCTTGAAAAG
GAACAAGAAAAGGAAAGAAAGAGATTAGAAAGAGAAGCCGCCTAATTGAAGGAATAGGAG
GAAAATTGGCTTAAGGAACTCAAGGAAGATACTCTTAAGGAAAACTACGGAGATTATATC
CTTGTTCAAAGTCAAGAAAAGACTGACAGAAAGTGGATTTAGGTATTTACTCATTCCTTA
TTACTTTATTTCATATTTTTAAAAGCTCATTTTCAACAACAAAAGTTCAAGTTTTTGTAT
CTTCTTTTGTAGCGCCACAAGCATAAACATAAAAAAGAGAAATACAATCAAATGAGTAAT
AAAAAATAGAAATGCATCAAGAAATTTTAGAAACTAATCTATAAATGCAAACATTTTATC
ATTTTATTAATAACTTTTATTTCTATAATGAATAGGTTTTGAGTATTGATGAATCAATGG
TCGGTTAAACCGTCTTGATCAGAGCAAGACTCCAAAATTCTAGAGTTAAGGGTAATGTCG
GTTTCTTAGTTTTGAGATAACAATTTTCTACCATCCAAGCTATGATCTCTAAGAACGACG
TCACTGTTTCTAAGACCATGGTTAAATGGGTTGGTAAGGTTCCTTGTGAATCTATCGTTG
ATGTTTACGGTGTTGTCTCTAAGCCTGAAACTGAAATTAAGAGTACTTCATGCAAACTTG
AATTGATTGTCAACAAGGTTTATGTTGTCTCTCGTTCAAGAGCTCAACTTCCTTTCCAAT
TAGAAGATGCTGCTAGATAATAAAAGAAGGAAGAACAATTAGCTGAATACAATAACAATG
AAGGTGATATTGAAGAATCTAAGGATAATTAAGCCAGTGTCTCCATTAAAACTCGTTTAG
ATAACAGAATTATTGATTTAAGAACTCCTGCCAAGCAAGCTATTTTCAGATTACAATCTG
GTATCTGCCAATTATTCCGTGAATACTTACTTTCATAAGATTTCGTTGAAATTCACACTC
CTAAGCTTATTGGTGGTTCTTCTGAAGGTGGTGCTAACATCTTCAAGTTGAAGTATTTCG
ATAAGGATGCTTGTCTTGCTTAATCTCCTTAACTCTACAAGTAAATGTGTATCTAATCTG
ACTTCGAAAGAGTCTTCGAAATAGGTCCCGTTTTCAGAGCTGAAAAATCATTCACCCATC
GTCACATGTGTGAATTCACTGGTTTGGATATTGAAATGTCCATTAAAGAAAACTACCATG
AGCTTCTTGATCTTATGGGTGATTTATTCGTCCACATCTTCAAGGGCTTAGAAACCAAAT
ACAGCAAGGAAATCGAAGCTATTTAATAATAATTCCCCTTCGAACCTTTCAAAATTAAAA
CCCCTGTTGTTAAACTCACTTTCGAAGAAGGTTGCAAACTCTTAAAAGAAGCTGGTATTG
AATAAAACCCCTTAGAAGATTTAGATACTGTTACTGAAAAGAAGCTTGGTGACATCGTCC
GTGAAAAGTATGATACTGATTTCTATATGCTCCATAGATATCCTATCTCTGCTAGACCTT
TCTACACCATGCTTTGCCACGATGATCCTAACTACACTCTTTCTTACGATTTCTTCATGA
GAGGTTAAGAAATCACCTCAGGTGCCTAAAGAAATCACGACCCCGTTTCTCTCGCTAAGC
GTGCTGCTGAATGTGGTATCAATGTAGAAACTATTAAAGATTATATTGAATCTATGGCTT
TCGGTGCTTATCCTCATGGTGGTTGTGGTATTGGTCTTGAAAGAGTTGTTTTCCTCTACT
GCGACCTTTACGATATTAGAAACGGTTGCTTATTCCCCAGAGATCCTAAAAGAATTGCTC
CTTGA