Identifiers and Description

Gene Model Identifier

TTHERM_00218320

Standard Name

DRP7 (Dynamin-Related Protein)

Aliases

PreTt22259 | 18.m00285 | 3701.m00045

Description

Dynamin central region family protein; localized to subcortical mitochondria

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF00350 ) Dynamin family
  • ( PF08477 ) Miro-like protein
  • ( PF01031 ) Dynamin central region
  • ( PF01926 ) GTPase of unknown function
  • ( PF02212 ) Dynamin GTPase effector domain
  • ( PF02575 ) Uncharacterized BCR, YbaB family COG0718

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00218320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06604.19.997093137033517e-262dynamin central region family
protein (773 aa)
OxytrichaContig17275.0.g479.997093137033517e-262Dynamin central region
SGDYLL001W5.000884911363751e-160DNM1 Dynamin-related GTPase re
quired for mitochondrial fissi
on and morphology; assembles o
n the cytoplasmic face of mito
chondrial tubules at sites at
which division will occur; als
o participates in endocytosis
and regulating peroxisome abun
dance
DictyBaseDDB_G02778499.001120252596697e-151dymA on chromosome: 3 position
252381 to 255025
WormBaseWBGene000010938.996335863931938e-133locus:drp-1 status:Confirmed
UniProt:Q8WQC9 protein_id
:CCD70526.1
Stentor CoeruleusSteCoe_193882.138865964899539e-62

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00218320(coding)
ATGGATAAACTCATACCTTTGATCAATGAAATTCATGATGTGTTAAGTAAATCGTAGCTC
AGTAATTAATTGAGACTTCCTTAGATAGTAGTTATTGGATCTCAATCAACAGGTAAGAGT
TCTCTTCTTGAAAGTATCGTTGGTTAGGAGATACTTCCAAGAGGTAAAGGAATAGTCACA
AGAAGACCAATAGAAATATAACTTAAAAATCAACAAAATGCAGAATAAGACTATGTCGAA
TTTAGTGAAAGAAGAGGAGAAAAAATTACAGATATGGATTAGGTTCGTAAAATGATTGAT
GAAGATACTGAAAAAATAGCTGGAAAAAACAAAGCAATTTCAAATGTCCCACTACGTCTA
AAATTCTATTCCAAAAATGTTGTTGATTTAATATTGGTAGATCTTCCTGGCATGACTAAG
AATCCAGTAGGAGATTAGCCATAGGACATTGAGTAGCAAATTCTTAATTTAATTGAGCCA
TACATTAAAAATCCAAATAGCATTATTATGGCCGTTTCTAAAGGTTCCGATGATCTTGCT
AATTCAGAAAGTTTGAAATTATCAAGAAAAATCGATCCATAAGGTAATAGAACTATAGGA
GTTATCACATAGCTTGATCTAATTGATGAAGGAGCTGATGTCCTTAATGATTTACAAAAT
AAAACATATCCTCTAAAATTAGGTTACGTGGGTGTAATCATGAGAGGCTAGAAAGACATT
AAAATAAAATCTATTAAGGAATAAATTGCAGATGAAAAAGCTTATTTTGAAAATCATTCT
ATCTATAAGCGTGTTTCCAATAAGATGGGTATACCTTACCTCATAAAATTACTAAATTTG
AGTTTGATGAACCATATAAAAAAGACACTGCCAAATATACGCGAAAATATAGTTTAAATG
CTCAACGATAGAGAAAACGATCTTAAACAATATGGTGACTATTCTTCTCTTGAGGATAAA
AAAGATAGAGGTATTTTTGTTCTCAGACTCATCTCTCAATTTACCAAATCATATAATTCA
CTCATATAAGGACATTACATTTAAACAAACAATGATGAACTTTAAGGAGGTTCTAGAATT
CAATATATATTCAATAATATATTCAGAAAGTCTATAACAGAATTAAATCCTTTTGACATT
CTCAAAGATGAAGATATTAGAACTGCTATTAAAAACGCTGATGGTTTGAGACAATCTTTA
TTTGTGGCTGAAGGAGCTTTCGAAAATTTAGTCAAGTAACAAATTTCTCGTTTACTAAAT
CCATCAATTCAATGCTCTCACCTCGTATACGAAGAACTCCGTAGAATCATAAATTTAATT
AATGTTCCAGAAATATAGCGCTTTGATAATTTTAACAATCGTATATTCTAAGTCATGGAA
GATGTTTTAGAAAGATCTTTGAAGCCCACTGACCAAATGATAAAAAATTTAATTGAAGTA
GAATTAGGATATATAAATACTAATCATCCAGATTTTATAGGAGGAATTGAATTAGTTTAA
AATTAATCAGAATAAATGTGCAAAGAAGAAGAATAAAAAAGGAATTAGTAAAAGCCTCAA
GCAGCTTAATATGCTAATAAAAATGAAAGGGGCTAAGAAACAGACTCTGATGCCAAATCA
GTCATTTCAAATAAATCACAAGCTATTGGAGGAATAGAAAGAAATTAGAAAAGACAGCAA
TCTTAAAACGTATAAGCAACTTCTTAATCAACTCCTACTGATTAAGATAGTAGTTTTTGG
TCTTGGCTCCCTTTCTCTTCTAAATAAAATAAACAAACAGAGTTATTGGATAGTAAGTTA
AAAATAATGAACATGAAAAAGCTTGCTGAAGAAAATTAAGGCAAAGATTTTAGTGATTCT
TATTCTTAAAACTCCCCTAAAGGATACACAAGAAGAGTATATAGAGAATTCATGGCACCA
TAATCGTATAATGATGATTATTCTATTAATAATATCAATTAAGGATACTAAGGAAATTTA
CCCTAGGTACCAACAAATATAAGACTTGAAGATAAGCCTTCAAAAAGAGAAATGAGTGAA
GCAGAAATGATTAAAAATTTAATAGTCTCATACTTTAATATAGTTAAAAAAAATATAAAT
GATTCTGTTCCCAAAACAATAGTATCTTTCTTAGTCAATAGAAGTGTTAATATAGCTGAG
AGAGAATTAGTAAGTAATTTATACAAAGAAGATATATTTGATGATTTATTAGCTGAAAAC
TCATACATTGCCAAATAAAGAGAAGAAACAAAAGCACAAATGATTCTTCTTAGGTCATGC
CTAAATGTCTTAAATGATCTTGATGCTAAATTTTGA


>TTHERM_00218320(protein)
MDKLIPLINEIHDVLSKSQLSNQLRLPQIVVIGSQSTGKSSLLESIVGQEILPRGKGIVT
RRPIEIQLKNQQNAEQDYVEFSERRGEKITDMDQVRKMIDEDTEKIAGKNKAISNVPLRL
KFYSKNVVDLILVDLPGMTKNPVGDQPQDIEQQILNLIEPYIKNPNSIIMAVSKGSDDLA
NSESLKLSRKIDPQGNRTIGVITQLDLIDEGADVLNDLQNKTYPLKLGYVGVIMRGQKDI
KIKSIKEQIADEKAYFENHSIYKRVSNKMGIPYLIKLLNLSLMNHIKKTLPNIRENIVQM
LNDRENDLKQYGDYSSLEDKKDRGIFVLRLISQFTKSYNSLIQGHYIQTNNDELQGGSRI
QYIFNNIFRKSITELNPFDILKDEDIRTAIKNADGLRQSLFVAEGAFENLVKQQISRLLN
PSIQCSHLVYEELRRIINLINVPEIQRFDNFNNRIFQVMEDVLERSLKPTDQMIKNLIEV
ELGYINTNHPDFIGGIELVQNQSEQMCKEEEQKRNQQKPQAAQYANKNERGQETDSDAKS
VISNKSQAIGGIERNQKRQQSQNVQATSQSTPTDQDSSFWSWLPFSSKQNKQTELLDSKL
KIMNMKKLAEENQGKDFSDSYSQNSPKGYTRRVYREFMAPQSYNDDYSINNINQGYQGNL
PQVPTNIRLEDKPSKREMSEAEMIKNLIVSYFNIVKKNINDSVPKTIVSFLVNRSVNIAE
RELVSNLYKEDIFDDLLAENSYIAKQREETKAQMILLRSCLNVLNDLDAKF


>TTHERM_00218320(gene)
ATGGATAAACTCATACCTTTGATCAATGAAATTCATGTAAACGAATTATTTATCTAGCTA
ATGTTTATTAAGAAGTACTTTCTTACTTTTAGGATGTGTTAAGTAAATCGTAGCTCAGTA
ATTAATTGAGACTTCCTTAGATAGTAGTTATTGGATCTCAATCAACAGGTAAGAGTTCTC
TTCTTGAAAGTATCGTTGGTTAGGAGATACTTCCAAGAGGTAAAGGAATAGTCACAAGAA
GACCAATAGAAATATAACTTAAAAATCAACAAAATGCAGAATAAGACTATGTCGAATTTA
GTGAAAGAAGAGGAGAAAAAATTACAGATATGGATTAGGTTCGTAAAATGATTGATGAAG
ATACTGAAAAAATAGCTGGAAAAAACAAAGCAATTTCAAATGTCCCACTACGTCTAAAAT
TCTATTCCAAAAATGTTGTTGATTTAATATTGGTAGATCTTCCTGGCATGACTAAGGTAA
TTAAAAGTTAAATTAAAATAGGCTTTAAAAATTTATTTTAGATCAATTCAAAAATTCTAT
TCGTTTTTTTTTGAACCATAATATTGTAAAAATAGCAATTTAGAAAAAGTAGACCTTAAA
TAAAAGAATTTGCAAATACTATTTTAAAATTAAATTATAATTTAAAAATAGAATCCAGTA
GGAGATTAGCCATAGGACATTGAGTAGCAAATTCTTAATTTAATTGAGCCATACATTAAA
AATCCAAATAGCATTATTATGGCCGTTTCTAAAGGTTCCGATGATCTTGCTAATTCAGAA
AGTTTGAAATTATCAAGAAAAATCGATCCATAAGGTAATAGAACTATAGGAGTTATCACA
TAGCTTGATCTAATTGATGAAGGAGCTGATGTCCTTAATGATTTACAAAATAAAACATAT
CCTCTAAAATTAGGTACACAATTAGTTTTAAAGACAAGCCATAATATAATTCAAATATTT
AACAGGTTACGTGGGTGTAATCATGAGAGGCTAGAAAGACATTAAAATAAAATCTATTAA
GGAATAAATTGCAGATGAAAAAGCTTATTTTGAAAATCATTCTATCTATAAGCGTGTTTC
CAATAAGATGGGTATACCTTACCTCATAAAATTACTAAATTTGAGTTTGATGAACCATAT
AAAAAAGACACTGCCAAATATACGCGAAAATATAGTTTAAATGCTCAACGATAGAGAAAA
CGATCTTAAACAATATGGTGACTATTCTTCTCTTGAGGATAAAAAAGATAGAGGTATTTT
TGTTCTCAGACTCATCTCTCAATTTACCAAATCATATAATTCACTCATATGTAATAATTA
CATTCTTATTTTATCTTCTTATTGAGTATTTATTAATAGCTTGATTAAGCTTGTTAGTAA
TAGCTAAAACTTATTTAATATGATAAAATAGAAGGACATTACATTTAAACAAACAATGAT
GAACTTTAAGGAGGTTCTAGAATTCAATATATATTCAATAATATATTCAGAAAGTCTATA
ACAGAATTAAATCCTTTTGACATTCTCAAAGATGAAGATATTAGAACTGCTATTAAAAAC
GCTGATGGTTTGAGACAATCTTTATTTGTGGCTGAAGGAGCTTTCGAAAATTTAGTCAAG
TAACAAATTTCTCGTTTACTAAATCCATCAATTCAATGCTCTCACCTCGTATACGAAGAA
CTCCGTAGAATCATAAATTTAATTAATGTTCCAGAAATATAGCGCTTTGATAATTTTAAC
AATCGTATATTCTAAGTCATGGAAGATGTTTTAGAAAGGTAAAGCTAAATAATTTAATAT
GTTTGCTTAAATTAAAAAAAAAATATATTTTTTGTATCATTCTTTTTAAATTTTTTTTTA
CAAAAAACTTATTTATAATTTATATTTATTTACTTTAAAAAAGATCTTTGAAGCCCACTG
ACCAAATGATAAAAAATTTAATTGAAGTAGAATTAGGATATATAAATACTAATCATCCAG
ATTTTATAGGAGGTAAGCATAATTATATTTTTATTGAAAAGCTAACGTAGTTAAATATTA
TAAAAAGGAATTGAATTAGTTTAAAATTAATCAGAATAAATGTGCAAAGAAGAAGAATAA
AAAAGGAATTAGTAAAAGCCTCAAGCAGCTTAATATGCTAATAAAAATGAAAGGGGCTAA
GAAACAGACTCTGATGCCAAATCAGTCATTTCAAATAAATCACAAGCTATTGGAGGAATA
GAAAGAAATTAGAAAAGACAGCAATCTTAAAACGTATAAGCAACTTCTTAATCAACTCCT
ACTGATTAAGATAGTAGTTTTTGGTCTTGGCTCCCTTTCTCTTCTAAATAAAATAAACAA
ACAGAGTTATTGGATAGTAAGTTAAAAATAATGAACATGAAAAAGCTTGCTGAAGTAAAA
TAAACTGTTCAATACATTGATATAAAATTTACTTAAAAAAAAAAGGAAAATTAAGGCAAA
GATTTTAGTGATTCTTATTCTTAAAACTCCCCTAAAGGATACACAAGAAGAGTATATAGA
GAATTCATGGCACCATAATCGTATAATGATGATTATTCTATTAATAATATCAATTAAGGA
TACTAAGGAAATTTACCCTAGGTAATATTTATTTTTGACTGAAAATTTAAAAACTTACAT
AAAATTAAGGTACCAACAAATATAAGACTTGAAGATAAGCCTTCAAAAAGAGAAATGAGT
GAAGCAGAAATGATTAAAAATTTAATAGTCTCATACTTTAATATAGTTAAAAAAAATATA
AATGATTCTGTTCCCAAAACAATAGTATCTTTCTTAGTCAATAGAGTAATTTTTTTATTT
AATAATTCTAATTCTTTTAAATTTTTTAATTACAATTTAATAACACTAACTAAAAAAGAT
ATCACTTATTTTTAATTCATTTAATATTTGTATTAAAAAAATTTATTTATTCAATCTAAT
TTCTAATAACACCCAAAATAATTTTTTTTTTGAATTTCTATATAATTCTGTTTTTAGAAA
ATTAATTGTTAAAATTAAAAAAAATGAAATTTAATTTTAAGTTATTGAATTTTTCTTAAA
ATATTTTTAGAGTGTTAATATAGCTGAGAGAGAATTAGTAAGTAATTTATACAAAGAAGA
TATATTTGATGATTTATTAGCTGAAAACTCATACATTGCCAAATAAAGAGAAGAAACAAA
AGCACAAATGATTCTTCTTAGGTCATGCCTAAATGTCTTAAATGATCTTGATGCTAAATT
TTGA