Identifiers and Description

Gene Model Identifier

TTHERM_01194760

Standard Name

DRP4 (Dynamin Related Protein)

Aliases

PreTt07513 | 270.m00039

Description

Dynamin central region family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF00350 ) Dynamin family
  • ( PF08477 ) Miro-like protein
  • ( PF01031 ) Dynamin central region
  • ( PF01926 ) GTPase of unknown function
  • ( PF02212 ) Dynamin GTPase effector domain
  • ( TIGR00072 ) hydrogenase maturation protease
  • ( PF08011 ) Protein of unknown function (DUF1703)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01194760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21014.19.997093137033517e-262dynamin central region family
protein (506 aa)
OxytrichaContig22482.0.g887.996289531394984e-82Dynamin central region
DictyBaseDDB_G02778491.0000310450948521e-65dymA on chromosome: 3 position
252381 to 255025
SGDYKR001C5.997098480211051e-62VPS1 Dynamin-like GTPase requi
red for vacuolar sorting; also
involved in actin cytoskeleto
n organization, endocytosis, l
ate Golgi-retention of some pr
oteins, regulation of peroxiso
me biogenesis
WormBaseWBGene000011309.996907204735647e-62locus:dyn-1 Dynamin status
:Confirmed UniProt:P39055
protein_id:CAB01857.1
Stentor CoeruleusSteCoe_59514.4737793061811207e-38

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16276403: Elde NC, Morgan G, Winey M, Sperling L, Turkewitz AP (2005) Elucidation of clathrin-mediated endocytosis in tetrahymena reveals an evolutionarily convergent recruitment of dynamin. PLoS genetics 1(5):e52

Sequences

>TTHERM_01194760(coding)
ATGACAAGCAGTGTTTCTACAAATAGCTTTCAAAACATTAAAGAAGTTATCAAGGTTGTA
AATAATCTTAGAGATTTTGGAGTAGAATCTGATAAAATTGAGCTTCCTAAAATAGTAGTT
ATTGGTGTTTAATCTTCAGGTAAGTCTTCACTTCTAGAGTAAATTGTCTAGATAGACTTT
TTACCTAGAGGTACTGGAGTAGTGACTCGTTGTCCTTTAGAAATAAGACTCATTGAAGTA
ACCAGCTATGCTAAAGATTTTAAGCCCTACGCTTACTTTTTTGAAGAAAGAAGCAAAACA
TATGAAAATTTTGAAGAAGTAAAAAAAAGAATTGAAACAATTACAAAGGAGCAAGCTGGA
GTAGGTAAAAAGATTGTTGATCAAGCAATAACTTTGACTATCTTCTAGACTAAATGCCCT
ACTTTGACTTTAATTGATTTACCAGGTATGACTTTGAATTCTATCGAAGACTAGGTCGAT
GTTGAAAAAGTTACTCAAGACATGACTTTAAAATACATCAAAGAAGAAACTACAATTATC
CTTTGTGTTATTCCTATCAACTAGGATTTAGAAAACTCTCTTGCTTTGAAGCTTGCTAGA
AATGTTGATAAAACTGGTAGTCGTACTATTGGAGTACTTACTATGATAGATATAATGAAT
CCAGGCACAAATTGTGAGAAAGTGTTAAGAAATTAGTAAATTCCACTTAAGCATAGATAT
TATGGTATGAAACCTCGTAATTAAAATGATATAAATAACAATATCACAGTTGAATAAGCT
ATAAAAAATGAATAAGAATATTTTTCAAACCATGAAGTTTACAAAGAGTTTGCTGATTAT
ACTGGCACAGCTGCCTTAACTCATAAACTTTCTACATTATTAGATAGTCACATTCGTCAC
TTTTTGCCAGATATTTTTAAAAAGATCTATTCTACTCTTCTTTAAAGAATAGAGTCAAGA
AAAAAATTAGGCGATCCTTTCCCTACTGATATCAACAAATAGTAAAAAGAGCTGAGAGAT
ATAATTAACAAATCTTTAAATATTTTCAAACAAGCTATGTAAGACTTTGATTTAACTGAA
GTTGAAAATATTGAAAAAATCTAAGTTGGAGAAAGAATGGGTAGAAATTATGTTGACTTT
TTAATGGATCATTATTCAGAATAAAATAGAGAATTATTCATTCAATCTCTCAAAAATGTT
GATATGAAAAAAGTCTAGCACGAACTTTAGAAGTTTAGAATTCCTGTTAACGGATTTATT
CCTTTCTAGGCCCTCCAATCTTAGATAAGATAGCATGTAAGTCACTATGAGCACAAAGCC
AAGGAGTTGCTTGAAAGTATAAAGGAATATTTAAAGAAAGTACTATATTTCTGCATTGAT
TAGTATCCTTATCCTAACCACTTTATAAAGAAAATGATTTAAGATCTAGTTTCAAAGTAT
ATTACAAAAGAATTTAAATTAACTAAAGCTCATATCGAAACAACATTCAAATGCTATAAA
GAATCCATATATTCAACAACGATTGATGTTCATGGCTATGAAACTAATTTAAAGTAATCT
TTTGTTATTAATTCTTTGGTCGCTAATTAGAAAAAATCTGTTTATGAATATATTACTAAA
AACACAAATTTCATGAAATGGACTATTTTTGATATAATTCATAAATCAGAATAGCTGTCA
GGAAAAACCATTTCAAGCTCAGAATATAATGATGTTGTATTGAAGACTGACGAAAAATAC
AATACTGACGAAATTATGAGATATTCTATCATATTTTATTAATATTTGGAAAACTTTAGA
AAATAGATCAGTGATTAAATTCCATAATTCATATAGACTTTATTTATCAACAGTCTATGT
AATTCACTCTTCTTAAATGTTGTAAACGATATTTTCAGCAATGAATGCAAAGAAGCTATG
GAAAAAAATCTTAAAGAAGATGCTAGATTGACTGAAGAAAGAAAGATTGTAGCTTAATCT
CTCAAAAAGCTTAAAAAAGCTTACATAACACTTAAATCCCTATAAGAAAAAAGCTTTGAT
TACTATTCATCAAGCTCTGTAACTTGTGAAAGTGAAGATCTTGTTTTACATTTTGAATGT
GAAGACACCTATTATGATGATGAAGATGATGAAGATTCTATCACAACTGTGTTTTGA


>TTHERM_01194760(protein)
MTSSVSTNSFQNIKEVIKVVNNLRDFGVESDKIELPKIVVIGVQSSGKSSLLEQIVQIDF
LPRGTGVVTRCPLEIRLIEVTSYAKDFKPYAYFFEERSKTYENFEEVKKRIETITKEQAG
VGKKIVDQAITLTIFQTKCPTLTLIDLPGMTLNSIEDQVDVEKVTQDMTLKYIKEETTII
LCVIPINQDLENSLALKLARNVDKTGSRTIGVLTMIDIMNPGTNCEKVLRNQQIPLKHRY
YGMKPRNQNDINNNITVEQAIKNEQEYFSNHEVYKEFADYTGTAALTHKLSTLLDSHIRH
FLPDIFKKIYSTLLQRIESRKKLGDPFPTDINKQQKELRDIINKSLNIFKQAMQDFDLTE
VENIEKIQVGERMGRNYVDFLMDHYSEQNRELFIQSLKNVDMKKVQHELQKFRIPVNGFI
PFQALQSQIRQHVSHYEHKAKELLESIKEYLKKVLYFCIDQYPYPNHFIKKMIQDLVSKY
ITKEFKLTKAHIETTFKCYKESIYSTTIDVHGYETNLKQSFVINSLVANQKKSVYEYITK
NTNFMKWTIFDIIHKSEQLSGKTISSSEYNDVVLKTDEKYNTDEIMRYSIIFYQYLENFR
KQISDQIPQFIQTLFINSLCNSLFLNVVNDIFSNECKEAMEKNLKEDARLTEERKIVAQS
LKKLKKAYITLKSLQEKSFDYYSSSSVTCESEDLVLHFECEDTYYDDEDDEDSITTVF


>TTHERM_01194760(gene)
ATGACAAGCAGTGTTTCTACAAATAGCTTTCAAAACATTAAAGAAGTTATCAAGGTTGTA
AATAATCTTAGAGATTTTGGAGTAGAATCTGATAAAATTGAGCTTCCTAAAATAGTAGTT
ATTGGTGTTTAATCTTCAGGTAAGTCTTCACTTCTAGAGTAAATTGTCTAGATAGACTTT
TTACCTAGAGGTACTGGAGTAGTGACTCGTTGTCCTTTAGAAATAAGACTCATTGAAGTA
ACCAGCTATGCTAAAGATTTTAAGCCCTACGCTTACTTTTTTGAAGAAAGAAGCAAAACA
TATGAAAATTTTGAAGAAGTAAAAAAAAGAATTGAAACAATTACAAAGGAGCAAGCTGGA
GTAGGTAAAAAGATTGTTGATCAAGCAATAACTTTGACTATCTTCTAGACTAAATGCCCT
ACTTTGACTTTAATTGATTTACCAGGTATGACTTTGAATTCTATCGAAGACTAGGTCGAT
GTTGAAAAAGTTACTCAAGACATGACTTTAAAATACATCAAAGAAGAAACTACAATTATC
CTTTGTGTTATTCCTATCAACTAGGATTTAGAAAACTCTCTTGCTTTGAAGCTTGCTAGA
AATGTTGATAAAACTGGTAGTCGTACTATTGGAGTACTTACTATGATAGATATAATGAAT
CCAGGCACAAATTGTGAGAAAGTGTTAAGAAATTAGTAAATTCCACTTAAGCATAGATAT
TATGGTATGAAACCTCGTAATTAAAATGATATAAATAACAATATCACAGTTGAATAAGCT
ATAAAAAATGAATAAGAATATTTTTCAAACCATGAAGTTTACAAAGAGTTTGCTGATTAT
ACTGGCACAGCTGCCTTAACTCATAAACTTTCTACATTATTAGATAGTCACATTCGTCAC
TTTTTGCCAGATATTTTTAAAAAGATCTATTCTACTCTTCTTTAAAGAATAGAGTCAAGA
AAAAAATTAGGCGATCCTTTCCCTACTGATATCAACAAATAGTAAAAAGAGCTGAGAGAT
ATAATTAACAAATCTTTAAATATTTTCAAACAAGCTATGTAAGACTTTGATTTAACTGAA
GTTGAAAATATTGAAAAAATCTAAGTTGGAGAAAGAATGGGTAGAAATTATGTTGACTTT
TTAATGGATCATTATTCAGAATAAAATAGAGAATTATTCATTCAATCTCTCAAAAATGTT
GATATGAAAAAAGTCTAGCACGAACTTTAGAAGTTTAGAATTCCTGTTAACGGATTTATT
CCTTTCTAGGCCCTCCAATCTTAGATAAGATAGCATGTAAGTCACTATGAGCACAAAGCC
AAGGAGTTGCTTGAAAGTATAAAGGAATATTTAAAGAAAGTACTATATTTCTGCATTGAT
TAGTATCCTTATCCTAACCACTTTATAAAGAAAATGATTTAAGATCTAGTTTCAAAGTAT
ATTACAAAAGAATTTAAATTAACTAAAGCTCATATCGAAACAACATTCAAATGCTATAAA
GAATCCATATATTCAACAACGATTGATGTTCATGGCTATGAAACTAATTTAAAGTAATCT
TTTGTTATTAATTCTTTGGTCGCTAATTAGAAAAAATCTGTTTATGAATATATTACTAAA
AACACAAATTTCATGAAATGGACTATTTTTGATATAATTCATAAATCAGAATAGCTGTCA
GGAAAAACCATTTCAAGCTCAGAATATAATGATGTTGTATTGAAGACTGACGAAAAATAC
AATACTGACGAAATTATGAGATATTCTATCATATTTTATTAATATTTGGAAAACTTTAGA
AAATAGATCAGTGATTAAATTCCATAATTCATATAGACTTTATTTATCAACAGTCTATGT
AATTCACTCTTCTTAAATGTTGTAAACGATATTTTCAGCAATGAATGCAAAGAAGCTATG
GAAAAAAATCTTAAAGAAGATGCTAGATTGACTGAAGAAAGAAAGATTGTAGCTTAATCT
CTCAAAAAGCTTAAAAAAGCTTACATAACACTTAAATCCCTATAAGAAAAAAGCTTTGAT
TACTATTCATCAAGCTCTGTAACTTGTGAAAGTGAAGATCTTGTTTTACATTTTGAATGT
GAAGACACCTATTATGATGATGAAGATGATGAAGATTCTATCACAACTGTGTTTTGA