Identifiers and Description

Gene Model Identifier

TTHERM_00188910

Standard Name

DRP2 (Dynamin-related protein 2)

Aliases

PreTt08641 | 15.m00352 | 3697.m00064

Description

Dynamin GTPase; GFP-tagged copy appears to localize, like DRP1-GFP, to the cell cortex and probably to parasomal sacs (unpublished)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00350 ) Dynamin family
  • ( PF08477 ) Miro-like protein
  • ( PF01031 ) Dynamin central region
  • ( PF01926 ) GTPase of unknown function
  • ( PF02212 ) Dynamin GTPase effector domain
  • ( PF08385 ) Dynein heavy chain, N-terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00188910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_139510
Tetrahymena borealisEI9_06319.19.997093137033517e-262dynamin central region family
protein (1730 aa)
OxytrichaContig22482.0.g889.997093137033517e-262Dynamin central region
SGDYKR001C9.99583921019208e-96VPS1 Dynamin-like GTPase requi
red for vacuolar sorting; also
involved in actin cytoskeleto
n organization, endocytosis, l
ate Golgi-retention of some pr
oteins, regulation of peroxiso
me biogenesis
DictyBaseDDB_G02778492.0001925730668994e-91dymA on chromosome: 3 position
252381 to 255025
WormBaseWBGene000011303.9991157591502974e-89locus:dyn-1 Dynamin status
:Confirmed UniProt:P39055
protein_id:CAC42251.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00188910(coding)
ATGGCCAGTGAACAAAGCACACTTGTCACAAATTTAAGAAAATTTGTTACTCTAGTTGAT
AGATTAAGAGATACCGGGCTTCACAAGTATATTGATTTACCTCGTATTGCAGTTTTAGGT
TCACAATCCGCAGGTAAATCATCATTACTTGAACAGATTGTTGGTCTTGATTTCTTACCA
AGAGGAGAGGGTACAGTCACAAGAAGACCTTTGGAAATGAGATTGTTTTATGTTCCAAAA
GAAAAATTAAGCATGCCTTATGGTGTATTTGAGGAAATTCCTGGATAAAAATTTACAGAT
TTCTAAATGGTTAAGTAAAATATAGATAAATTAACTAATAATGTTGCTGGTGCAAACAAG
GGTATAGTAGACAAACCTATTGTGCTTACTATTTACTCATCAACTTGCCCTGATCTTACT
ATTGTAGATTTACCAGGTATTACAAAAATTCCAATTAGGGGAACTGATCAAACCTAGGAT
ATTGAAAAAATCACTAAAGAAATGGCAGCAAGATACTGCAAAGACCCTAAAACTATTATT
TTGTGTGTTATTCCTGCTAATGCTGATATTACCACTTCTGATGGTTTGATGATGGCAAGA
TAGCTTGATCCACAAGGTTCAAGAACTATTGGATGTATCACTAAAATTGATATTATGGAT
AAAGGTACTGATGCTAGAAGACTGCTTACTGGTGAAGATGTAGGTTTGAAACTTGGTTAT
GTTGGTATTAAGAATCGTTCCTAAGCTGATATTAATGAAAAAAAAACTGTGTTGTAATCT
CTTGATGATGAAAGAAAATTCTTCTCTACAAGTCCTATTTACTCTTCATTACCTTCAAGT
TTACTTGGTACAAGATCTCTTACTAATAAGTTGACTGATGTTCTTTATACACACATCAGA
ACTTGCTTACCTCAAATCATTTCTGAAATTCAAAAGTAAATTAATGAAAAGGAATAAAGA
TTGAAAGAATTAGGAACTGGTATGCCAGAAGAGGAAAAGGATAAGCTTAAATACTTATGG
AAGGTCATTAATGATTTCTCAACTGCTTTCAAAAATTCAATTAATGGTAGTTATGATAAA
TTAGCTACTTTTGACAAAAATAAATTACCTGCTGGTCATAGAATTAGAGTTATATTAACA
GACTTGTACTCAGATATCAGATCTTTTAAACCTACTGAACAATACAGTGATATTGATATT
AAAAATGCTATTATAAAGCATGAAGGTGACAGTATTCCTGGTTTCCCTTCCATTGATGCC
TTTTTAGCCTTATTGACACCTCTACTTTAAAAATTAAAAGACCCTGCCTTTGAGTGTGTT
AATGAAGTTTACCACGTTTTAGAGGAAATTGCTACAAATATTTTAGATAAGATTGTCAGC
AAAGTTCCTGCTCTCAAAGAAGAATTGCAAGACAATATTCTTTAACATTTCAAAAACGAA
AGAGACTCTTGTAGAGATAAAATTGAAAGTTTGATTGATTCTGAAATTGGTTATATTTTT
ACAAATGATGTTGAATATCTTACAAGCAGAGCCTCCTCTAGTGTCAAGGATAATCCTCCT
ATTGATCCTAAGCAACCTATTCCCAAAAATAACCAAGGATAGGGAAATTAAGCTCCTTTC
AGTTAAAATTATTAGAGATAAAGTGGAGATCCCTTAGTTCATGAATTAAGATATAGACTT
GACGATTACTTTAGTCTTGTTATGAGAGGTATTCGTGATTCCGTTCCTAAATTTATTGGA
TACTTCCTCGTTAAAGCTTCATAATTCAAATTATAATAAACCTTATTCGAAGCAACTAAC
AGAAGTGAAAAATACTTTAACTTGATGGCTGAACCAACTCATATTGTTGAAGAAAGAAAA
AATTTAGCAAGTGCTGTTGAAACATTAAAGACTTCAATTAAAATGATTAGAAGAGATCCA
GACTTTTCAAGTTATGAAAAGTATGCTAAACCTGCTAATGATGTTTAAAAGGAAAGAGAT
ATTGCTCTTTCTTCTAGCTCTGGTAAGAAGAATAATGGACCAGCTTAACCTCCTCCACCT
CGCCATTAAAACTCTGCAAATAATAGTATGACAGATATAAAACCAAACCAAACAGGAGCT
CCATAAAATCCCAACAATAGCTTCTCTGGATCAAATTAAAATCAACAAAATTAAAACCGT
GGAGCCATCTTCCCTCCAGGCTAATAGTAAAGACCAGTAGCTAATCCTTTGGGTAATCCT
AATCCTTAACAAGGCGTTCCACAGTAAGTAAACCCTGTGGGTACAAAACCAAACACTGGA
AACGCTTTTGTTATTGGAAACTAACCAAATAATCCAAATTAAAATAATAATAATAGCAAT
CCTAATTTAAATAATAACAGCAATAATAATGTCAACTAGCAACCAAAAACTATGAATCTT
TTTGGAAACAAACCAATTCCTAACTAAGGTGGTTAAGTTCCTCCTGGTGGTTAACCAGTT
AACTAAGGTGGTAATTAACCTCCTGTCTAACAGCCACCTATGACCCATTAGATCGTAGAT
AAAGCTGTTGATAAAACTTTTGAAAATCCATAATTTTAAAAAGGATTATAGAATGCTGCT
TCTGCAGGAGCCAAATAGGCCTTTGGTAATAACGCCATAGGTGAAGCAGCTGGTAAAGGT
GCAGCATAATTAGTTTAAAACTAAGCAGTATAGGATGCTATGAAAGATCAAGCTAAGTAA
TAAGGCAAAGCATAAGCTGATTAAAAAGCTACAGAAGCAAAAGCATCTTTCAAATTCTGG
TGA


>TTHERM_00188910(protein)
MASEQSTLVTNLRKFVTLVDRLRDTGLHKYIDLPRIAVLGSQSAGKSSLLEQIVGLDFLP
RGEGTVTRRPLEMRLFYVPKEKLSMPYGVFEEIPGQKFTDFQMVKQNIDKLTNNVAGANK
GIVDKPIVLTIYSSTCPDLTIVDLPGITKIPIRGTDQTQDIEKITKEMAARYCKDPKTII
LCVIPANADITTSDGLMMARQLDPQGSRTIGCITKIDIMDKGTDARRLLTGEDVGLKLGY
VGIKNRSQADINEKKTVLQSLDDERKFFSTSPIYSSLPSSLLGTRSLTNKLTDVLYTHIR
TCLPQIISEIQKQINEKEQRLKELGTGMPEEEKDKLKYLWKVINDFSTAFKNSINGSYDK
LATFDKNKLPAGHRIRVILTDLYSDIRSFKPTEQYSDIDIKNAIIKHEGDSIPGFPSIDA
FLALLTPLLQKLKDPAFECVNEVYHVLEEIATNILDKIVSKVPALKEELQDNILQHFKNE
RDSCRDKIESLIDSEIGYIFTNDVEYLTSRASSSVKDNPPIDPKQPIPKNNQGQGNQAPF
SQNYQRQSGDPLVHELRYRLDDYFSLVMRGIRDSVPKFIGYFLVKASQFKLQQTLFEATN
RSEKYFNLMAEPTHIVEERKNLASAVETLKTSIKMIRRDPDFSSYEKYAKPANDVQKERD
IALSSSSGKKNNGPAQPPPPRHQNSANNSMTDIKPNQTGAPQNPNNSFSGSNQNQQNQNR
GAIFPPGQQQRPVANPLGNPNPQQGVPQQVNPVGTKPNTGNAFVIGNQPNNPNQNNNNSN
PNLNNNSNNNVNQQPKTMNLFGNKPIPNQGGQVPPGGQPVNQGGNQPPVQQPPMTHQIVD
KAVDKTFENPQFQKGLQNAASAGAKQAFGNNAIGEAAGKGAAQLVQNQAVQDAMKDQAKQ
QGKAQADQKATEAKASFKFW


>TTHERM_00188910(gene)
ATGGCCAGTGAACAAAGCACACTTGTCACAAATTTAAGAAAATTTGTTACTCTAGTTGAT
AGATTAAGAGATACCGGGCTTCACAAGTATATTGATTTACCTCGTATTGCAGTTTTAGGT
TCACAATCCGCAGGTAAATCATCATTACTTGAACAGATTGTTGGTCTTGATTTCTTACCA
AGAGGAGAGGTAAATGCTTACTTATTTATAGTTCATAGCTATATTGATCTACATTATTTG
TTTTATTTTACTTGAGCTTAATTTTTAGCCATCCTCCATCTTTACTCAAGAAGTTAATTT
AGCGATTTTATAGCTTTTAAATGGAAAGGCAAAACCAATTTTAAGATCATCTGAACAAGA
TATCTAATTAAATATTTTTTTAGGCTTTAAAGTAAAGCAAGTAAAAATAAAATGCGATAC
ATCAAAATTAGCAAAATTAGAATTTCTTTATAGCAATAAAAGTGTTATGTTAATTTATAT
ATCAATTATTTTATTTTTAAAGGGTACAGTCACAAGAAGACCTTTGGAAATGAGATTGTT
TTATGTTCCAAAAGAAAAATTAAGCATGCCTTATGGTGTATTTGAGGAAATTCCTGGATA
AAAATTTACAGATTTCTAAATGGTTAAGTAAAATATAGATAAATTAACTAATAATGTTGC
TGGTGCAAACAAGGGTATAGTAGACAAACCTATTGTGCTTACTATTTACTCATCAACTTG
CCCTGATCTTACTATTGTAGATTTACCAGGTATTACAAAAATTCCAATTAGGGGAACTGA
TCAAACCTAGGATATTGAAAAAATCACTAAAGAAATGGCAGCAAGGTAACTTATTATTTA
AAATAATAAAACGATTATAAAATGAGCAAATAGTATATTGTGAATAATTGAGATTTTGAA
ACAAAACAAACAAATCAGCAGCAACGAAGCGCAAAAATACTTTAATACATATATACATAG
AAATATATTGAATAAATTTTGCTGAATTAATTATAGAATTGATTGATCAAATTTCTAATA
TTTAACTTTTGATCTATATATCTATCTATTCCCTTTAAAAATTCAAGTATGAGAAAAAAA
TAAATATTATGTAGGAAAGTGTTTCATTTGTCCCTTCTCCTCATTAAGCAAAATTTTGTT
ATTAAATGCGTAAAAATGTTAATAACTTAGTAACTAGCTTACTTTCCTCAAACCATTTTG
TAAAATCAACAAAATAATATCATAAAAATAGCACTTTTAAAAATAAAAATCTCACAAAAA
CAAAATAAAACTAAAAGAAAATTAGTCATTTTAAATAAATAAATAAACAAATAAACAAAC
AAACCTAATGATAAAATTTATTAAATTTAAATTATGGTGAACAAAATATTTAAATAAAAT
TAAATTAAAATTTAGATACTGCAAAGACCCTAAAACTATTATTTTGTGTGTTATTCCTGC
TAATGCTGATATTACCACTTCTGATGGTTTGATGATGGCAAGATAGCTTGATCCACAAGG
TTCAAGAACTATTGGATGTATCACTAAAATTGATATTATGGATAAAGGTACTGATGCTAG
AAGACTGCTTACTGGTGAAGATGTAGGTTTGAAACTTGGTTATGTTGGTATTAAGAATCG
TTCCTAAGCTGATATTAATGAAAAAAAAACTGTGTTGTAATCTCTTGATGATGAAAGAAA
ATTCTTCTCTACAAGTCCTATTTACTCTTCATTACCTTCAAGTTTACTTGGTACAAGATC
TCTTACTAATAAGTTGACTGATGTTCTTTATACACACATCAGAACTTGCTTACCTCAAAT
CATTTCTGAAATTCAAAAGTAAATTAATGAAAAGGAATAAAGATTGAAAGAATTAGGAAC
TGGTATGCCAGAAGAGGAAAAGGATAAGCTTAAATACTTATGGAAGGTGAGTTTTAATTG
AATTTTGTTTTAATTATTAATTAAAATTGTTATAAAATAAATAATAAATAGGTCATTAAT
GATTTCTCAACTGCTTTCAAAAATTCAATTAATGGTAGTTATGATAAATTAGCTACTTTT
GACAAAAATAAATTACCTGCTGGTCATAGAATTAGAGTTATATTAACAGACTTGTACTCA
GATATCAGATCTTTTAAACCTACTGAACAATACAGTGATATTGATATTAAAAATGCTATT
ATAAAGCATGAAGGTGACAGTATTCCTGGTTTCCCTTCCATTGATGCCTTTTTAGCCTTA
TTGACACCTCTACTTTAAAAATTAAAAGACCCTGCCTTTGAGTGTGTTAATGAAGTTTAC
CACGTTTTAGAGGAAATTGCTACAAATATTTTAGATAAGATTGTCAGCAAAGTTCCTGCT
CTCAAAGAAGAATTGCAAGACAATATTCTTTAACATTTCAAAAACGTAAATGATTTATTA
AATATTTAATTGCTAACTAATACAATGAATATTTTTTAATTTTAGGAAAGAGACTCTTGT
AGAGATAAAATTGAAAGTTTGATTGATTCTGAAATTGGTTATATTTTTACAAATGATGTT
GAATATCTTACAAGCAGAGCCTCCTCTAGTGTCAAGGATAATCCTCCTATTGATCCTAAG
CAACCTATTCCCAAAAATAACCAAGGATAGGGAAATTAAGCTCCTTTCAGTTAAAATTAT
TAGAGATAAAGTGGAGATCCCTTAGTTCATGAATTAAGATATAGACTTGACGATTACTTT
AGTCTTGTTATGAGAGGTATTCGTGATTCCGTTCCTAAATTTATTGGATACTTCCTCGTT
AAAGCTTCATAAGTAAATTAATATTATATAATGAGATAAACTCTCTTAAATTAATAAAAC
TTTTAATTAATTATTAGTTCAAATTATAATAAACCTTATTCGAAGCAACTAACAGAAGTG
AAAAATACTTTAACTTGATGGCTGAAGTAATTAAACAATTTATTTTTTTATTTAAAAATT
TTTTCATTTATTTTTCAATTTATCTAATCAATAATTGATCTAAATTAAATATTATTTTTT
AATTTTAAAGCCAACTCATATTGTTGAAGAAAGAAAAAATTTAGCAAGTGCTGTTGAAAC
ATTAAAGACTTCAATTAAAATGATTAGAAGAGATCCAGACTTTTCAAGTTATGAAAAGTA
TGCTAAACCTGCTAATGTAATTCATTAATTAATTTAATAAAATTAAAATTTAAAATTTAC
ATTTTTAATAGGATGTTTAAAAGGAAAGAGATATTGCTCTTTCTTCTAGCTCTGGTAAGA
AGAATAATGGACCAGCTTAACCTCCTCCACCTCGCCATTAAAACTCTGCAAATAATAGTA
TGACAGATATAAAACCAAACCAAACAGGAGCTCCATAAAATCCCAACAATAGCTTCTCTG
GATCAAATTAAAATCAACAAAATTAAAACCGTGGAGCCATCTTCCCTCCAGGCTAATAGT
AAAGACCAGTAGCTAATCCTTTGGGTAATCCTAATCCTTAACAAGGCGTTCCACAGTAAG
TAAACCCTGTGGGTACAAAACCAAACACTGGAAACGCTTTTGTTATTGGAAACTAACCAA
ATAATCCAAATTAAAATAATAATAATAGCAATCCTAATTTAAATAATAACAGCAATAATA
ATGTCAACTAGCAACCAAAAACTATGAATCTTTTTGGAAACAAACCAATTCCTAACTAAG
GTGGTTAAGTTCCTCCTGGTGGTTAACCAGTTAACTAAGGTGGTAATTAACCTCCTGTCT
AACAGCCACCTATGACCCATTAGATCGTAGATAAAGCTGTTGATAAAACTTTTGAAAATC
CATAATTTTAAAAAGGATTATAGAATGCTGCTTCTGCAGGAGCCAAATAGGCCTTTGGTA
ATAACGCCATAGGTGAAGCAGCTGGTAAAGGTGCAGCATAATTAGTTTAAAACTAAGCAG
TATAGGATGCTATGAAAGATCAAGCTAAGTAATAAGGCAAAGCATAAGCTGATTAAAAAG
CTACAGAAGCAAAAGCATCTTTCAAATTCTGGTGA