Identifiers and Description

Gene Model Identifier

TTHERM_00486790

Standard Name

DRP1 (Dynamin Related Protein 1)

Aliases

PreTt19610 | 59.m00248 | 3680.m00105

Description

Dynamin-related protein (DRP); localized to endocytic sites; essential for growth; DRP1 expression required for clathrin-mediated endocytosis; one of 8 DRP genes in Tetrahymena

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF03789 ) ELK domain
  • ( PF00350 ) Dynamin family
  • ( PF01031 ) Dynamin central region
  • ( PF01926 ) GTPase of unknown function
  • ( PF02212 ) Dynamin GTPase effector domain
  • ( PF08256 ) Aurein-like antibiotic peptide

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00486790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_59510
Tetrahymena borealisEI9_12179.19.997093137033517e-262dynamin central region family
protein (643 aa)
OxytrichaContig22482.0.g889.997093137033517e-262Dynamin central region
SGDYKR001C9.999242092827953e-100VPS1 Dynamin-like GTPase requi
red for vacuolar sorting; also
involved in actin cytoskeleto
n organization, endocytosis, l
ate Golgi-retention of some pr
oteins, regulation of peroxiso
me biogenesis
DictyBaseDDB_G02778493.9985196551577655e-99dymA on chromosome: 3 position
252381 to 255025
WormBaseWBGene000010937.998415523157811e-91locus:drp-1 status:Confirmed
UniProt:Q8WQC9 protein_id
:CCD70526.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16276403: Elde NC, Morgan G, Winey M, Sperling L, Turkewitz AP (2005) Elucidation of clathrin-mediated endocytosis in tetrahymena reveals an evolutionarily convergent recruitment of dynamin. PLoS genetics 1(5):e52

Sequences

>TTHERM_00486790(coding)
ATGGCTGAGCAAGAAAGTTCATTTTAGGGATCAGGTCTTTTTGATAACCTTAGAAAGTTA
ATTAACGTCATCGATGAATTAAGAGATGTCGGTTTACAACAATATATTAGATTGCCTAGA
ATCGCAGTTATTGGTTCTTAATCATCTGGTAAATCATCTCTTCTCGAAAGTATCGTTGGT
ATCGATTTCTTGCCAAGAGGTTCTGGTGTAGTTACTCGTAGACCTTTAGAACTCAGATTA
GTTCATGTGCCTCCCAATGAAAGATAAATCAAGCCATATGCTATTTTCGATGTTGATAAA
TCAAAGAAGTGGGAAAACTTTGATTAGGTTAGATAACAAATCGATTTCTTAACTGACCAA
GTTGCAGGTAAGAGAAAGAAAATTATCAATGACCCTATCGTATTGACTATTTACTCAAAT
GATGTTATCGATTTGACAATTATTGATTTGCCTGGTATTACAAGAATTCCCTTAAAAGAT
TCAGACCAATAAGAAGATATCGAAAAAGTTACTAAAGATATGGCTTACTCATACATAAAA
GATGAAAGAACAATTATTTTGTGTGTTGTTCCTGGTAACTAGGATATTTCTAACTCCGAT
GGTCTCTAATTAGCTAGAGAAGTAGACAGAGAAGGCAATAGAACAATTGGTGTTGTTACA
AAACTTGATATCATGGATGCTGATACTGATGCAAGAAAAATGATCATGGGTCTTGAAATT
CCTTTGAAATTAGGATATGTTGGTGTCAAGGGTAGATCTCAAAAGGATATTAATGACAAT
AAGAGAGTTTCTAAAGCTCTTGACGAAGAAAGACTTTTCTTTGCTTAGCATAAAGTATAC
TCAACTATGGATCCTAAGTTCTTAGGTACTAAAGCTTTGACTAATAAGTTATCAAGTGTG
CTTTTCTATCACATTAGAAATATTTTACCTGCTATCGTCAAGGAAATTAAAGATAAATTG
AAAGAATGTGAAGATAGACTTAAAGACTTGGGTCCCTCTCTTCCAAGAGAACAAAAAGAT
AAAATGCAACTTATCTGGACCATGATTACTGATTTTACTGAAAACTTTAAAAATACAATT
AAGGGTAAATACGATCAAAGACGTTCTAATATTAATACAGAATTATCTGGTGGTGCAGTT
ATTAAGATGATGTTCAATGAGCTTTATGAAGATTTCATTTAAAAAACCTTTAGAGCAACT
AGAGAATATAGCGATAAAGATATTTAAACAGCTATTTAATTGCATTAAGGTGATTCTATT
CCAGGTTTCCCCTCAATAGATGCTTTCTTATATTTAATTAATCCTCAATTAGAAAAGCTA
AAAGACCCTGCCTTTGAATGCTTAACTTAATGCTACAATTATTTGGAAGGTTTAGCTAAT
AAGATTTTGAAGAAAATATTCTCAAGATTCCCCACTGTTATGGACGAAATTGCAGATATT
ACAAGCAGAGTGCTTCAAGCTTAAAGAGATTAAGCAAAAGAAGTTGTTAACAATATTATT
GAATCTGAATAAGGTTACCTTTTCACTAATGATTTAGGCTATCTTGCTCACAGAACTCAT
TTGATTCCAGCTCAAGAATCTGGTAAAGAAGGTTAACAATAGATAGATGCTGAAAAAGCT
TTTATTAATGAATTGAGATCTAGAGTAGACGTTTACTTCAATATCGTTGTCAGAAATGTA
AGAGACTCTATTCCTAAGGCTATTGGTTTCTTCTTAGTTAAGGCTGCTTAAGAATAATTG
TAATATTAATTATATAATGAAATTATGAGAAGTGAAGATTCTCTTGGTAGCATTGCAGAA
CCTGCCAACATCGCAGAAGAAAGAGATACACTCAATAAAACTATCGAAGTTCTTCAAAAG
GCTCATAGAGTTATTAAGAGAGATCCTGATCTTCAACCCAGATATGATGGATAGAATCCT
TAAAAGCAAGTTGTTTGA


>TTHERM_00486790(protein)
MAEQESSFQGSGLFDNLRKLINVIDELRDVGLQQYIRLPRIAVIGSQSSGKSSLLESIVG
IDFLPRGSGVVTRRPLELRLVHVPPNERQIKPYAIFDVDKSKKWENFDQVRQQIDFLTDQ
VAGKRKKIINDPIVLTIYSNDVIDLTIIDLPGITRIPLKDSDQQEDIEKVTKDMAYSYIK
DERTIILCVVPGNQDISNSDGLQLAREVDREGNRTIGVVTKLDIMDADTDARKMIMGLEI
PLKLGYVGVKGRSQKDINDNKRVSKALDEERLFFAQHKVYSTMDPKFLGTKALTNKLSSV
LFYHIRNILPAIVKEIKDKLKECEDRLKDLGPSLPREQKDKMQLIWTMITDFTENFKNTI
KGKYDQRRSNINTELSGGAVIKMMFNELYEDFIQKTFRATREYSDKDIQTAIQLHQGDSI
PGFPSIDAFLYLINPQLEKLKDPAFECLTQCYNYLEGLANKILKKIFSRFPTVMDEIADI
TSRVLQAQRDQAKEVVNNIIESEQGYLFTNDLGYLAHRTHLIPAQESGKEGQQQIDAEKA
FINELRSRVDVYFNIVVRNVRDSIPKAIGFFLVKAAQEQLQYQLYNEIMRSEDSLGSIAE
PANIAEERDTLNKTIEVLQKAHRVIKRDPDLQPRYDGQNPQKQVV


>TTHERM_00486790(gene)
ATGGCTGAGCAAGAAAGTTCATTTTAGGGATCAGGTCTTTTTGATAACCTTAGAAAGTTA
ATTAACGTCATCGATGAATTAAGAGATGTCGGTTTACAACAATATATTAGATTGCCTAGA
ATCGCAGTTATTGGTTCTTAATCATCTGGTAAATCATCTCTTCTCGAAAGTATCGTTGGT
ATCGATTTCTTGCCAAGAGGTTCTGTAAGCTTTAAAATTAAAATACTCTTAATAAGTTAT
TTAAATTTAATCTACCTATAACAAAATAGGGTGTAGTTACTCGTAGACCTTTAGAACTCA
GATTAGTTCATGTGCCTCCCAGTAATAAAAAAGCATTTTTGTTTTTACATATTTTTATGA
ATATTTGAAAACAGTGAACATAAAACAATCTTTTTCTAACTTAAATGAAAAAAAATTTAC
TGATTAGATAGAATTTGATTGCGCTAGAATAGAATATCAAAATAAATTGAATCTAAAATA
TGAAACATTTTATTAATTTCAAACTATAAAAATTAGATGAAAGATAAATCAAGCCATATG
CTATTTTCGATGTTGATAAATCAAAGAAGTGGGAAAACTTTGATTAGGTTAGATAACAAA
TCGATTTCTTAACTGACCAAGTTGCAGGTAAGAGAAAGAAAATTATCAATGACCCTATCG
TATTGACTATTTACTCAAATGATGTTATCGATTTGACAATTATTGATTTGCCTGGTATTA
CAAGAATTCCCTTAAAAGATTCAGACCAATAAGAAGATATCGAAAAAGTTACTAAAGATA
TGGCTTACTCGTAACTTATTTTTTATATAATTACAAATGTTTTAATAGTAAATTATAGCC
AAAAGCTTCCATCAAAGCAACCTTCTTTGAAAAAAATTAAAGGAGTTTTTTAACTTAAGT
TATGAGGCGATTTTGTTAAAATTATCCAAATTAAAAGCAATACATCAATAAAAAATACTT
AATCATGCACACATTTTAAACAAAAATTATTATAAAAATAGATACATAAAAGATGAAAGA
ACAATTATTTTGTGTGTTGTTCCTGGTAACTAGGATATTTCTAACTCCGATGGTCTCTAA
TTAGCTAGAGAAGTAGACAGAGAAGGCAATAGAACAATTGGTGTTGTTACAAAAGTATGC
AGCATTTATTTCTTAAATATAAAAAATAAATAAATATTTTAGAGGCTATTTATTCTAAAT
TTGCTTTATTTAATTAAAAAAGCTTGATATCATGGATGCTGATACTGATGCAAGAAAAAT
GATCATGGGTCTTGAAATTCCTTTGAAATTAGGATATGTTGGTGTCAAGGGTAGATCTCA
AAAGGATATTAATGACAATAAGAGAGTTTCTAAAGCTCTTGACGAAGAAAGACTTTTCTT
TGCTTAGCATAAAGTATACTCAACTATGGATCCTAAGTTCTTAGGTACTAAAGCTTTGAC
TAATAAGTTATCAAGTGTGCTTTTCTATCACATTAGAAATATTTTACCTGCTATCGTCAA
GGAAATTAAAGATAAATTGAAAGAATGTGAAGATAGACTTAAAGACTTGGGTCCCTCTCT
TCCAAGAGAACAAAAAGATAAAATGCAACTTATCTGGACCATGATTACTGATTTTACTGA
AAACTTTAAAAATACAATTAAGGGTAAATACGATCAAAGACGTTCTAATATTAATACAGA
ATTATCTGGTGGTGCAGTTATTAAGATGATGGTAAATAAATTTACCTTATCATTAATTAT
TAATCATACATTTTTATATAATTAATTAAATAGTTCAATGAGCTTTATGAAGATTTCATT
TAAAAAACCTTTAGAGCAACTAGAGAATATAGCGATAAAGATATTTAAACAGCTATTTAA
TTGCATTAAGGTGATTCTATTCCAGGTTTCCCCTCAATAGATGCTTTCTTATATTTAATT
AATCCTCAATTAGAAAAGCTAAAAGACCCTGCCTTTGAATGCTTAACTTAATGCTACAAT
TATTTGGAAGGTTTAGCTAATAAGATTTTGAAGAAAATATTCTCAAGATTCCCCACTGTT
ATGGACGAAATTGCAGATATTACAAGCAGAGTGCTTCAAGCTGTAAATTTACTTTAATTT
TTATTTAAAAAGATATTTAGCTCAATATTTAAAATTAAAATAGTAAAGAGATTAAGCAAA
AGAAGTTGTTAACAATATTATTGAATCTGAATAAGGTTACCTTTTCACTAATGATTTAGG
CTATCTTGCTCACAGAACTCATTTGATTCCAGTATATTTTAATATTCTCAAACTTTTTAT
AAATAATTTTAATTAAAAAAAAAGGCTCAAGAATCTGGTAAAGAAGGTTAACAATAGATA
GATGCTGAAAAAGCTTTTATTAATGAATTGAGATCTAGAGTAGACGTTTACTTCAATATC
GTTGTCAGAAATGTAAGAGACTCTATTCCTAAGGCTATTGGTTTCTTCTTAGTTAAGGCT
GCTTAAGAATAATTGTAATATTAATTATATAATGAAATTATGAGAAGTGAAGATTCTCTT
GGTAGCATTGCAGAAGTATGTTTTTTTTTTCAAATAGTTAAAACCAAATTTAATCTTATT
TTTTTCTTCAATCTAGCCTGCCAACATCGCAGAAGAAAGAGATACACTCAATAAAACTAT
CGAAGTTCTTCAAAAGGCTCATAGAGTTATTAAGAGAGATCCTGAGTAATTTTATTTCAA
AAATGTAATTGTTTAAATAAATATTTTTTTTTAAATAGTCTTCAACCCAGATATGATGGA
TAGAATCCTTAAAAGCAAGTTGTTTGA