Identifiers and Description

Gene Model Identifier

TTHERM_00187140

Standard Name

DRH9 (DExD/H box RNA helicase 9)

Aliases

PreTt29931 | 14.m00498

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF03789 ) ELK domain
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF09312 ) SurA N-terminal domain
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF06862 ) Protein of unknown function (DUF1253)
  • ( PF07262 ) Protein of unknown function (DUF1436)
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family
  • ( PF08597 ) Translation initiation factor eIF3 subunit
  • ( TIGR00255 ) conserved hypothetical protein TIGR00255
  • ( TIGR00055 ) di-trans,poly-cis-decaprenylcistransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00187140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_41055.19.997093137033517e-262hypothetical protein (641 aa)
DictyBaseDDB_G02817114.0007306071632746e-129ddx27 on chromosome: 3 positio
n 4866495 to 4869027
WormBaseWBGene000221484.0013270407672343e-119status:Confirmed UniProt:Q95
XM9 protein_id:CCD67990.1
SGDYLL008W5.0008352594020174e-107DRS1 Nucleolar DEAD-box protei
n required for ribosome assemb
ly and function, including syn
thesis of 60S ribosomal subuni
ts; constituent of 66S pre-rib
osomal particles
OxytrichaContig22569.0.g637.003377498796081e-81DEAD/DEAH box helicase
Stentor CoeruleusSteCoe_201374.0795586671775603e-41

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00187140(coding)
ATGTTCAAAAAAGGACAGAAAAAATAGCAAGCTTAGCAAAAGCAGGTTTAAAATAAATAG
CCTAAAAAGGTTTAGCAAGAAGAAACTGACTTGATGGTAAACATCGAAGAGGAAATCAAG
AGTAATTATGAAGATAGCGGCGATTCTGATGAAGAATTTGAAGCTGTTGATAATGGATTC
TTCTCAGGATTAGGTGGAGAATCAAAGGTAAAAGACTAAAATATAACCAAGGTTATTGAG
GCTACTAAGTAAGATTACGAATCTAAGATGACCACTCTTGAATAAAAGGTTAAAAGACGT
TAAAGAAGGGTTAAAGAAACTTTAGATAACAGTGATGATGAAGAATAAGAAGAAAATGAT
AATGAAAATGATTCTGATGAAGAAGAAATTGAAAAAAAGCATAAAAATAAGAAGAACGTT
AACAAAGCTTCAAATGATAAAGTATTAAAAATGGCTAAAGAAAAGTTAGACAATGAAAGC
GAACATGAAGATGATGATATGGGAACATAGATCAATCAAAATGCAAATAAAAAGCTAAAA
GAATAAAAGCTCAACAAGAAGAAGAAGAAAACATGGTAAGATTTAGGTTTAATTAAACCT
TTACTAAAGGCAGTTGAAGAAATGCAATATGAATTCCCAACTAACATTCAATCTCTTGCT
ATTCCTGCTGCTTTGCAAGGCAAAGATCTCTTGGCTAGTTCTTTAACAGGTTCTGGCAAA
ACTGCAGCTTTCTTGATTCCAATCCTCTAAAAGTTCTACAGATCACCATTTACAAACTAC
AGCAAGGCATTAATTGTCACTCCTACTAGAGAATTAGCTTTCTAGATTTATGAGGTTTTC
ACTAAATTAAATAAATATACAAAACTTAGAGCTTGTTTAGTCATAGGATAAAGTGCCATG
TAAAAGCAAGAAGCTGAACTTAGAGGAAATCCTGAAGTAATTATTGCTACTCCTGGTAGA
CTTATTGATCATTTGCAAAACTCTAGATCTATTGATTTGGATAACTTAGAAGTATTAATA
TTTGATGAAGCAGATAAGTTATTAGATCTTGGTTTCGAAGCAGCAGCTCAAAATATTGTA
GAGAATTGTAATAGAGAAAGACAAACACTTCTATTCTCTGCTACACTTACCAGTGAAGTC
AACAAGCTTATCGACATAGCACTTAGAAAACCTATTAGAATATAAGCCAATCCAGATGGT
TAAACTAATGACAAGCTCATTTAAAAGATGCTTAGAATATAACATGAAGATTTTAGAGAA
GCAGCACTTTTAGCTATAGCAGCTAAGTACTACAAAGAAAGAACAATTATATTCTTCAAG
ACTAAAAGATAAACCCATAGAATGGCAATTATTTTTGGTCTTTTCGGATTAAAAGTTTGT
GAGTTGCATGGTGATTTAACTTAAAATTAAAGAATTTAAGCTTTTAGTGATTTTAAGGAG
GGAAAATACTAATATTTAATGGCCACTGATTTAGCATCTAGAGGTTTAGATATATAAGGA
GTAAAAGCTGTTATTAATTTTGAATTGCCTAGTGAAGTTACTAGATATATTCATAGAGTT
GGTAGAACTGCTAGAGCTGGTAATGAAGGTATATCTTTAACTATTGGTCTTGATGCTGAA
TTAAAAACTCTCAAGAAAATGCTTAAAGAAAATAAAGATAAAATGATGGAAAAAGTTAGT
TTGTCTGTTGAAACATTATAAAAATATAAAGAAAAAATACAAAATGTAGAAAGGGAAGTT
GTTAAAGTTTTAGAAGAAGAATAAGCTGAAAGATAACTCAGAAAGGCTGAAATGGAGTTG
CAAAAAGCTGAAAACATGATAAAGCATAAAGATGAAATTATGAATAAACCCAAAAAGACT
TGGTTCCAAACTAATCATGAAAGAAATAAAATCAAAGAAGCTGCAAAGGCAGCTGCTTTA
GGTGAAAAATGA


>TTHERM_00187140(protein)
MFKKGQKKQQAQQKQVQNKQPKKVQQEETDLMVNIEEEIKSNYEDSGDSDEEFEAVDNGF
FSGLGGESKVKDQNITKVIEATKQDYESKMTTLEQKVKRRQRRVKETLDNSDDEEQEEND
NENDSDEEEIEKKHKNKKNVNKASNDKVLKMAKEKLDNESEHEDDDMGTQINQNANKKLK
EQKLNKKKKKTWQDLGLIKPLLKAVEEMQYEFPTNIQSLAIPAALQGKDLLASSLTGSGK
TAAFLIPILQKFYRSPFTNYSKALIVTPTRELAFQIYEVFTKLNKYTKLRACLVIGQSAM
QKQEAELRGNPEVIIATPGRLIDHLQNSRSIDLDNLEVLIFDEADKLLDLGFEAAAQNIV
ENCNRERQTLLFSATLTSEVNKLIDIALRKPIRIQANPDGQTNDKLIQKMLRIQHEDFRE
AALLAIAAKYYKERTIIFFKTKRQTHRMAIIFGLFGLKVCELHGDLTQNQRIQAFSDFKE
GKYQYLMATDLASRGLDIQGVKAVINFELPSEVTRYIHRVGRTARAGNEGISLTIGLDAE
LKTLKKMLKENKDKMMEKVSLSVETLQKYKEKIQNVEREVVKVLEEEQAERQLRKAEMEL
QKAENMIKHKDEIMNKPKKTWFQTNHERNKIKEAAKAAALGEK


>TTHERM_00187140(gene)
ATGTTCAAAAAAGGACAGAAAAAATAGCAAGCTTAGCAAAAGCAGGTTTAAAATAAATAG
CCTAAAAAGGTTTAGCAAGAAGAAACTGACTTGATGGTAAACATCGAAGAGGAAATCAAG
AGTAATTATGAAGATAGCGGCGATTCTGATGAAGAATTTGAAGCTGTTGATAATGGATTC
TTCTCAGGATTAGGTGGAGAATCAAAGGTAAAAGACTAAAATATAACCAAGGTTATTGAG
GCTACTAAGTAAGATTACGAATCTAAGATGACCACTCTTGAATAAAAGGTTAAAAGACGT
TAAAGAAGGGTTAAAGAAACTTTAGATAACAGTGATGATGAAGAATAAGAAGAAAATGAT
AATGAAAATGATTCTGATGAAGAAGAAATTGAAAAAAAGCATAAAAATAAGAAGAACGTT
AACAAAGCTTCAAATGATAAAGTATTAAAAATGGCTAAAGAAAAGTTAGACAATGAAAGC
GAACATGAAGATGATGATATGGGAACATAGATCAATCAAAATGCAAATAAAAAGCTAAAA
GAATAAAAGCTCAACAAGAAGAAGAAGAAAACATGGTAAGATTTAGGTTTAATTAAACCT
TTACTAAAGGCAGTTGAAGAAATGCAATATGAATTCCCAACTAACATTCAATCTCTTGCT
ATTCCTGCTGCTTTGCAAGGCAAAGATCTCTTGGCTAGTTCTTTAACAGGTAAAAAATTT
ACAAATAAATTTAAAAAATTAAAATTTTATTTAGCAAACGAACAAATAAATCATGTTGTA
ATCAAAATTTGAATTAAAATAGGTTCTGGCAAAACTGCAGCTTTCTTGATTCCAATCCTC
TAAAAGTTCTACAGATCACCATTTACAAACTACAGCAAGGTAATTAAATTAATTTTTTGT
TTTATTTGTTGAGTAGAGTTTTCTTGTGCATAAAGCTAATAAAAGCTTATGTAGAAATAA
TTAAAGTTATAAATTATCAAATTAATACATTTAGATTGATATTTTTGTATCAAATTTATT
AATTTTGAAATTTAACACCTACTTTCTTTCTTTCTATATTTTTGCTATTAATTCAAACAC
AAAATCTCATAAAGTCTTTTTCATCAAAAATTCGATTTTATTAAAAATATTGTTTTAAAT
AGTTTTCATTAAAATAAACTTTAAAAAATTGAAATAATTCTAAAAAATAATAGGCATTAA
TTGTCACTCCTACTAGAGAATTAGCTTTCTAGATTTATGAGGTTTTCACTAAATTAAATA
AATATACAAAACTTAGAGCTTGTTTAGTCATAGGATAAAGTGCCATGTAAAAGCAAGAAG
CTGAACTTAGAGGAAATCCTGAAGTAATTATTGCTACTCCTGGTAGACTTATTGATCATT
TGCAAAACTCTAGATCTATTGATTTGGATAACTTAGAAGTATTAATATTTGATGAAGCAG
ATAAGTTATTAGATCTTGGTTTCGAAGCAGCAGCTCAAAATATTGTAGAGAATTGTAATA
GAGAAAGACAAACACTTCTATTCTCTGCTACACTTACCAGTGAAGTCAACAAGCTTATCG
ACATAGCACTTAGAAAACCTATTAGGTAAAAATTTATTTATTATTAAAAAATTGTTTTAA
TGATTAATATTTTAAAGAATATAAGCCAATCCAGATGGTTAAACTAATGACAAGCTCATT
TAAAAGATGCTTAGAATATAACATGAAGATTTTAGAGAAGCAGCACTTTTAGCTATAGCA
GCTAAGTACTACAAAGAAAGAACAATTATATTCTTCAAGACTAAAAGATAAACCCATAGA
ATGGCAATTATTTTTGGTCTTTTCGGATTAAAAGTTTGTGAGTTGCATGGTGATTTAACT
TAAAATTAAAGAATTTAAGCTTTTAGTGATTTTAAGGAGGGAAAATACTAATATTTAATG
GCCACTGATTTAGCATCTAGAGGTTTAGATATATAAGGAGTAAAAGCTGTTATTAATTTT
GAATTGCCTAGTGAAGTTACTAGATATATTCATAGAGTTGGTAGAACTGCTAGAGCTGGT
AATGAAGGTATATCTTTAACTATTGGTCTTGATGCTGAATTAAAAACTCTCAAGAAAATG
CTTAAAGAAAATAAAGATAAAATGATGGAAAAAGTTAGTTTGTCTGTTGAAACATTATAA
AAATATAAAGAAAAAATACAAAATGTAGAAAGGGAAGTTGTTAAAGTTTTAGAAGAAGAA
TAAGCTGAAAGATAACTCAGAAAGGCTGAAATGGAGTTGCAAAAAGCTGAAAACATGATA
AAGCATAAAGATGAAATTATGAATAAACCCAAAAAGACTTGGTTCCAAACTAATCATGAA
AGAAATAAAATCAAAGAAGCTGCAAAGGCAGCTGCTTTAGGTGAAAAATGA