Identifiers and Description

Gene Model Identifier

TTHERM_00131240

Standard Name

DRH8 (DExD/H box RNA helicase 8)

Aliases

PreTt24245 | 10.m00294 | 3698.m00018

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF09073 ) BUD22
  • ( PF02815 ) MIR domain
  • ( PF04006 ) Mpp10 protein
  • ( PF02414 ) Borrelia ORF-A
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF08512 ) Histone chaperone Rttp106-like
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF07198 ) Protein of unknown function (DUF1410)
  • ( PF04851 ) type III restriction enzyme, res
  • ( PF08619 ) Alkali metal cation/H+ antiporter Nha1
  • ( PF05793 ) Transcription initiation factor IIF, alpha

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.8%

TetraMine Data

TTHERM_00131240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05684.19.997093137033517e-262DEAD/DEAH box helicase (859 aa
)
OxytrichaContig10050.0.g1089.996696112986116e-50DEAD/DEAH box helicase
DictyBaseDDB_G02818419.997441244797434e-45ddx24 on chromosome: 3 positio
n 5000989 to 5003811
WormBaseWBGene000188905.0019039340728934e-39status:Confirmed UniProt:P91
340 protein_id:CCD71883.1
SGDYBR142W2.998577119979921e-31MAK5 Essential nucleolar prote
in, putative DEAD-box RNA heli
case required for maintenance
of M1 dsRNA virus; involved in
biogenesis of large (60S) rib
osomal subunits
Stentor CoeruleusSteCoe_360002.3195228302435696e-16

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00131240(coding)
ATGAGTCATTAAACAAATTAAGACTGGAGTAAATGGGACTTAATCCACCCATAGGTCCTT
TAGTCACTTAAGGACAATAATTTCAATAATCCTACAGAAATTTAAGCTTATGTTTTGAAT
ACCTATAGAAATTATAATGATTTTTTAATCGCATCCCAAACAGGTTCTGGTAAAACTTTA
AGTTTTGGTATTCCAATTGTTAGTGAAATTCTTTATGACAAGTCTGGTGCATTTGCTGAA
AAAAAAAAGGATCAAAAGAAAAAGGAAAAGTATATTAGATGCTTAATTATTGCACCAACT
AGAGAATTGGTCCTCCAAATTGAAAAACATCTCAATTAAATCAGTTAAAACTCAAAAGAT
CAAATCAGAATAGGTAGTATAGTTGGTGGTATATCTAAAGAAAAGCAAAGAAGAATTCTT
AGTTATGTTCCAGATATTTTAATTGCAACTCCCGGTCGTCTTTGGGATATGATTGATAAT
TATGAGCATGAGTGTTTAGAAAAATTATACATGCTTGACTATTTAGTTTTGGATGAAGCT
GACAGAATGGTAGAACTAGGTCACTTCGATGAATTGGATAAAATTCTTGAAAAAGTTTAT
AATAAAGGTGAAATCGTCGAAAATAAGGCTGATATTTAGAGACTCAATCAATTAATTAAA
GAAAAGAAAACTAAAACTATTTAGCTAAGAACAAAGGCAGAACTTCCTCAATCTTCTAAA
AATAAATTAGATTAAGTCGGTGAAAATGAAGTCATGACTTTATCAGGTGATGAAGCCAAG
AAGTTCTTTGCTTCCCTTAGAAAGAATAATTAACTTGATCAAAATGAATTAAAAGGCATT
AATCTTGATTTCCTCGATGATGAAAACTACATTAATTCTACTTAAGACAAAGAATCATAG
GAAGGAGAAGAAGACGAAGAGGATTTTGAAGATGTAGATGATGATGAAGAAGAAGAAGCT
GATGAAGAAGAAGAAGCTGATGAAGATGAAGATGATGAGGAGGAGGAAGAAGAAGAAGAA
GAAGAAGATGATTAAGAAGAATAGAATGAAAATGAGTTAGAAAATTAAGAAGATGAAGAA
AGCGGAAATGAAATTGATGAAGAAGAAGATGAAGAAAATGAAGAAGATTAAGAAAGTGAA
AATGAAAATTAAGATGAATTAAATGAAGAAGGTGATCATAATGAAAACGAAGATGAATTA
GATGATTAAGAATTAGAAGGTGAAGAGGAGAATGAATAAGAAGGAGAAGAAGATTTAGAA
AACTTAGAAGGTTTAAATTTAGAGAAACCTAAAAGAAACACTAAACTGAAAGTTTTCTTA
GTAAGTGCTACATTGACTAAGCAGTTTGCTGGTAATAAACATAAGGTGAAGGCATTATCT
AAAAAGGAAAAGAAAAAACTTAATAAGGAGAAAAAAGAGAAGAAGAAATCTAAAGAAGAA
GAAAAAGAAGAAAAAATGATTCCTAAAATGGAAGCCTTAATGAATAAAGTCAAGTTTAGT
GGAAAATACAAAGTAATTGATTTGACATAAACCATGTTGATTCCTAAGAATTTAAAGGAA
TGCAAGACAGTTTGTGTAGAAGAAGATAAAGTTCTCTATCTTTACCACTACTTATAACAA
AGACCTACTGAAAATGCTATTATTTTCACTAATTCGATCTCATATGCTAAAAAGATTGTG
CACTTATTAGAAATTCTAGGAATGAAAGTTCTCTGTATGCACTCTGAAATGTAACAACGT
TAGCGTCTTAAAAAACTTGATTAGTTTAAGAATGGACAGTACAGTATTTTGGTATCTACT
GATGTTGCTGCTAGAGGTTTAGATATTCCTTCTGTTTAAAATGTAGTTCATTACTAAGTT
CCATTAGATATTGACACATATATCCACAGAAGTGGTAGAACTGCTCGTATCGGAAAAGCA
GGTACTTGCTACACTTTAATTGGTCCTAAGGATGGTCAAAGATTCTAAAAAATAATCAAA
CAATTAGACAAAGAATAGGGAATTTAGAATATTGAAATTAATCATACAGAAAGAGATAAG
ATTAGAGTTCTAATTGACAGTGCTTAACAACTTGAAAAAAGTGATTTTCTTGTTAGACAA
AAGTAAGTTGAGAAGGCTTGGTATAGTAAAAATGCAAAATTAGCAGAAATAGAAGTTGAC
GAAGAAATTAAAAATGAGTTAAATATAATTAAAGAAGATTTATCAAAGAAGAGAGTAGTA
ATGAAGCAAGATAGAGTAGAATTTAAAAAGATTAAAGAAGATATTAAATAGATTCATAGA
AGACCAAACAATATGTTCCTTGAGCCATCTTAAATTTAAAAATATTTAGAAAGAATAGAA
CAATTAAAAGCCAGCAAAAGCAAGAACAAATCCTAACAAAAAGAATAAAATAAGTAGTAA
TAACAGTAACAACAGTAACAACCATAATAAAAGCATGGAAAAGGAAACAAATTCTAAAAA
TTCAACAACAAGAATAAAAATAATAATTAGAATAAAAATAATAACTAACCTGATAAATTT
AATAAAAAGAGAAGAAATTCTTAAAGATGA


>TTHERM_00131240(protein)
MSHQTNQDWSKWDLIHPQVLQSLKDNNFNNPTEIQAYVLNTYRNYNDFLIASQTGSGKTL
SFGIPIVSEILYDKSGAFAEKKKDQKKKEKYIRCLIIAPTRELVLQIEKHLNQISQNSKD
QIRIGSIVGGISKEKQRRILSYVPDILIATPGRLWDMIDNYEHECLEKLYMLDYLVLDEA
DRMVELGHFDELDKILEKVYNKGEIVENKADIQRLNQLIKEKKTKTIQLRTKAELPQSSK
NKLDQVGENEVMTLSGDEAKKFFASLRKNNQLDQNELKGINLDFLDDENYINSTQDKESQ
EGEEDEEDFEDVDDDEEEEADEEEEADEDEDDEEEEEEEEEEDDQEEQNENELENQEDEE
SGNEIDEEEDEENEEDQESENENQDELNEEGDHNENEDELDDQELEGEEENEQEGEEDLE
NLEGLNLEKPKRNTKLKVFLVSATLTKQFAGNKHKVKALSKKEKKKLNKEKKEKKKSKEE
EKEEKMIPKMEALMNKVKFSGKYKVIDLTQTMLIPKNLKECKTVCVEEDKVLYLYHYLQQ
RPTENAIIFTNSISYAKKIVHLLEILGMKVLCMHSEMQQRQRLKKLDQFKNGQYSILVST
DVAARGLDIPSVQNVVHYQVPLDIDTYIHRSGRTARIGKAGTCYTLIGPKDGQRFQKIIK
QLDKEQGIQNIEINHTERDKIRVLIDSAQQLEKSDFLVRQKQVEKAWYSKNAKLAEIEVD
EEIKNELNIIKEDLSKKRVVMKQDRVEFKKIKEDIKQIHRRPNNMFLEPSQIQKYLERIE
QLKASKSKNKSQQKEQNKQQQQQQQQQPQQKHGKGNKFQKFNNKNKNNNQNKNNNQPDKF
NKKRRNSQR


>TTHERM_00131240(gene)
ATGAGTCATTAAACAAATTAAGACTGGAGTAAATGGGACTTAATCCACCCATAGGTCCTT
TAGTCACTTAAGGACAATAATTTCAATAATCCTACAGAAATTTAAGCTTATGTTTTGAAT
ACCTATAGAAATTATAATGATTTTTTAATCGCATCCCAAACAGTAAATATTTTTTTACAA
CTTAATTGTAAATGTAAGCATAAATTCATCTATTATTTTAATACTAAAGGGTTCTGGTAA
AACTTTAAGTTTTGGTATTCCAATTGTTAGTGAAATTCTTTATGACAAGTCTGGTGCATT
TGCTGAAAAAAAAAAGGATCAAAAGAAAAAGGAAAAGTATATTAGATGCTTAATTATTGC
ACCAACTAGAGAATTGGTCCTCCAAATTGAAAAACATCTCAATTAAATCAGTTAAAACTC
AAAAGATCAAATCAGAATAGGTAGTATAGTTGGTGGTATATCTAAAGAAAAGCAAAGAAG
AATTCTTAGTTATGTTCCAGATATTTTAATTGCAACTCCCGGTCGTCTTTGGGATATGAT
TGATAATTATGAGCATGAGTGTTTAGAAAAATTATACATGCTTGACTATTTAGTTTTGGA
TGAAGCTGACAGAATGGTAGAACTAGGTCACTTCGATGAATTGGATAAAATTCTTGAAAA
AGTTTATAATAAAGGTGAAATCGTCGAAAATAAGGCTGATATTTAGAGACTCAATCAATT
AATTAAAGAAAAGAAAACTAAAACTATTTAGCTAAGAACAAAGGCAGAACTTCCTCAATC
TTCTAAAAATAAATTAGATTAAGTCGGTGAAAATGAAGTCATGACTTTATCAGGTGATGA
AGCCAAGAAGTTCTTTGCTTCCCTTAGAAAGAATAATTAACTTGATCAAAATGAATTAAA
AGGCATTAATCTTGATTTCCTCGATGATGAAAACTACATTAATTCTACTTAAGACAAAGA
ATCATAGGAAGGAGAAGAAGACGAAGAGGATTTTGAAGATGTAGATGATGATGAAGAAGA
AGAAGCTGATGAAGAAGAAGAAGCTGATGAAGATGAAGATGATGAGGAGGAGGAAGAAGA
AGAAGAAGAAGAAGATGATTAAGAAGAATAGAATGAAAATGAGTTAGAAAATTAAGAAGA
TGAAGAAAGCGGAAATGAAATTGATGAAGAAGAAGATGAAGAAAATGAAGAAGATTAAGA
AAGTGAAAATGAAAATTAAGATGAATTAAATGAAGAAGGTGATCATAATGAAAACGAAGA
TGAATTAGATGATTAAGAATTAGAAGGTGAAGAGGAGAATGAATAAGAAGGAGAAGAAGA
TTTAGAAAACTTAGAAGGTTTAAATTTAGAGAAACCTAAAAGAAACACTAAACTGAAAGT
TTTCTTAGTAAGTGCTACATTGACTAAGCAGTTTGCTGGTAATAAACATAAGGTGAAGGC
ATTATCTAAAAAGGAAAAGAAAAAACTTAATAAGGAGAAAAAAGAGAAGAAGAAATCTAA
AGAAGAAGAAAAAGAAGAAAAAATGATTCCTAAAATGGAAGCCTTAATGAATAAAGTCAA
GTTTAGTGGAAAATACAAAGTAATTGATTTGACATAAACCATGTTGATTCCTAAGAATTT
AAAGGAATGCAAGACAGTTTGTGTAGAAGAAGATAAAGTTCTCTATCTTTACCACTACTT
ATAACAAAGACCTACTGAAAATGCTATTATTTTCACTAATTCGATCTCATATGCTAAAAA
GATTGTGCACTTATTAGAAATTCTAGGAATGAAAGTTCTCTGTATGCACTCTGAAATGTA
ACAACGTTAGCGTCTTAAAAAACTTGATTAGTTTAAGAATGGACAGGTAATTGATTAAAA
TTTTTTTTAATTATGTAATTATAAATATTTTTTTATTAAAATTAGTACAGTATTTTGGTA
TCTACTGATGTTGCTGCTAGAGGTTTAGATATTCCTTCTGTTTAAAATGTAGTTCATTAC
TAAGTTCCATTAGATATTGACACATATATCCACAGAAGTGGTAGAACTGCTCGTATCGGA
AAAGCAGGTACTTGCTACACTTTAATTGGTCCTAAGGATGGTCAAAGATTCTAAAAAATA
ATCAAACAATTAGACAAAGAATAGGGAATTTAGAATATTGAAATTAATCATACAGAAAGA
GATAAGATTAGTAAAATTTTAATTTTTCTTATTTATATTAAATCTTAATTTTTTTAATTT
ATAGGAGTTCTAATTGACAGTGCTTAACAACTTGAAAAAAGTGATTTTCTTGTTAGACAA
AAGTAAGTTGAGAAGGCTTGGTATAGTAAAAATGCAAAATTAGCAGAAATAGAAGTTGAC
GAAGAAATTAAAAATGAGTTAAATATAATTAAAGAAGATTTATCAAAGAAGAGAGTAGTA
ATGAAGCAAGATAGAGTAGAATTTAAAAAGATTAAAGAAGATATTAAATAGATTCATAGA
AGACCAAACAATATGTTCCTTGAGCCATCTTAAATTTAAAAATATTTAGAAAGAATAGAA
CAATTAAAAGCCAGCAAAAGCAAGAACAAATCCTAACAAAAAGAATAAAATAAGTAGTAA
TAACAGTAACAACAGTAACAACCATAATAAAAGCATGGAAAAGGAAACAAATTCTAAAAA
TTCAACAACAAGAATAAAAATAATAATTAGAATAAAAATAATAACTAACCTGATAAATTT
AATAAAAAGAGAAGAAATTCTTAAAGATGA