Identifiers and Description

Gene Model Identifier

TTHERM_00455140

Standard Name

DRH7 (DExD/H box RNA helicase 7)

Aliases

PreTt20243 | 53.m00145 | 3712.m00006

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00627 ) UBA/TS-N domain
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF04935 ) Surfeit locus protein 6
  • ( PF04702 ) Vicilin N terminal region
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00455140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13711.19.997093137033517e-262DEAD/DEAH box helicase (769 aa
)
OxytrichaContig17817.0.g491.0004137340105782e-93DEAD/DEAH box helicase
SGDYMR290C2.000597631390999e-64HAS1 ATP-dependent RNA helicas
e; localizes to both the nucle
ar periphery and nucleolus; hi
ghly enriched in nuclear pore
complex fractions; constituent
of 66S pre-ribosomal particle
s
DictyBaseDDB_G02840174.0015855602347305e-61ddx10 on chromosome: 4 positio
n 1436851 to 1439670
WormBaseWBGene000152329.997652352281279e-57status:Confirmed UniProt:O61
815 protein_id:CCD62102.1
Stentor CoeruleusSteCoe_161281.7587922024243116e-25

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00455140(coding)
ATGGATGACGATATTATGATTAACTTTGGTGATTTTGCACCTAAAAAAGTAGCTGATCCT
AGCAAAAACGAAACATAGGCACGTAGAGAAAAGTATAAGCAAAAGGCATTTGAACAAAAA
ACAAATTATAAAAATTTCCTCAAGAGATAAAGAGAAAAAACTTAACAAAATAGCGACGAC
ATAGAATAAGGCAATGTTTTAAAAGTTAAAAAGCCTATCTCTAAGAACCAAGATTTTAAA
AAAAGTACAAACAGGACGATTCCAAAGTTAGCAGAAGTCACTTGCTGCGAAGAAAATAAT
CCTGAATAGCAAGCTGACAACAAACAAGAAAACCAATAAGATTCTACAAAGCAAAATAAG
TTTAAGAAAGACTTCAAGTAATACTTGGAATAATCTTAAAAGGGAGGAGATTATGATAAC
GAAATATAAAAGATTATGCATTAGGAATAAAATAATGTTGAGCGTACTAAATAAAAGTAA
AATATGAGACGTGAAAACAAATAAAAAAGTGAAGAATAAGAGCAAATAAAGGAGTAAAAG
TAATAGGAAATGATGCAAAAAGTTGTTTATCCTTTCACTGAAAAAGATTAAGAATAGTAA
AAGCTCTCCGTCTTCACAGCTGAGAAATTCGGAGAAATAGAGTAAATTCATCCTAAAGTT
GTCTAAGCCTTACAAGAAAGCAACTACGAAACAATGACTAAAATTTAAAAAGAAGGTATT
CCTTAGATTTTAAAAAAAGAAAATATCGCTTTGAAGAGTGAAACAGGTTCTGGTAAAACT
TTAACTTATTTGGTTCCTATTATTTCGAATCTTGTCCACATGGGTACTGATCAAAAGATT
ACTAGAGAAGATGGTAGCTATGTTTTTGTAATTTGCCCTACTAGAGAATTGTGCATTTAG
TGCGAAGAAGTTGCGCAATTAGTTACTAAAAAATCAAAATATTTGATTACAGGTTGCTTG
ATGGGAGGTGAAAATCCTAAAAAAGAAAAAGCTAGATTAAGAAAAGGAGTAACCATCCTA
TTTGCCACACCTGGTAGATTGCTATATCACCTCAAAAATACTAATTCCTTCTTGTTTAGC
AAGCTCAAGTACATTGTTTTCGAAGAATCTGATAGAACATTAGATATGGGTTTCAAGAAA
GATTTAGAAGAAATCGTAGAATAGCTTACATAGAAAGTCTCCTTCGAGGAAGTATAAAAA
ATTCTTATTTCAGCTAACTTCAATGACAGTGTAGAAAGTCTTTACTTGAAGATGTCTACC
TAGACTATCAAATACGTTGGATTTGCTAAGCAAAAGAGAAATAAAGCAGATGGACCAATA
AACTATGAAGAAGAAAAGAAACATATAAAGGGAGATGACATGTTCAAAGTCCCAGATACA
TTGATTTAGTATTATTCTTTGATAAATGAAGAGCACAGAGTACCATTTTTAGTATCTTAC
CTTAGCATGCTTTAGGATACTAAATCTATTATTTTCGTATCAACTTGTGACGAAGTTGAT
TATTTTGCTTTCCTTTTCGATGCAATGAGGTATAAGGATGCTAACGGTGAAGTATAGTAG
GATGATTAGGTTTTAAAATAAAAGATATTTAAGCTACATGGTAATATAGAGCAAAGGACT
CGTAGTGAAACTTACTTTTCTTTCAAGAGATACTAGGGAGGAGCTATCCTCATTTCAACA
GATGTAGCCAGTAGAGGTTTAGATTTTTACGAAGTAACTCACACTATTTTATTCGATGTA
CCCACTAGCATCAGTGAGTATTGTAATAGAATTGGTAGAACTGCACGTATAGATTAAAAG
GGTATTTCTTTACTCATTTTGAATAATGTAGAAAGACCCTATGTTGATAAAATGAAAAAA
TATGGAATTAAATTGAACAAATTCGATGACGAGCCTGTTCTTGACAAAGTATAAAGAGAA
ATCAAATAAAAGTATGATGTCGGTATGGATACTATGCACTATGTAGAAAGTTTAATTAGG
TAATCTATAAGAGACGATAAAACTAAATATATATTAGCTCGTAGAGCTTATGTAAGTAGC
TTAAGAGCTTATGCCAGACTCAAAGACAAAGATATATTCCGTGTCAAAAAACTTAATTTA
CATTTAATAGCCAAGGGATTCGGTTTAAGTGGAGTCAAGGCTGGCAATGAAACTACCTCC
AAGCAATATCAACATGAACTTGTTGAAGCTAATAAGAATAGATATGATAAGATGGAGAAA
TTCTTTATGGAAAGATTAGAAAAAACAGCTCCTAAGAGAAAAGCAATGAACTCTAAAAAA
TTATTTAATATGGAATTCATGTGA


>TTHERM_00455140(protein)
MDDDIMINFGDFAPKKVADPSKNETQARREKYKQKAFEQKTNYKNFLKRQREKTQQNSDD
IEQGNVLKVKKPISKNQDFKKSTNRTIPKLAEVTCCEENNPEQQADNKQENQQDSTKQNK
FKKDFKQYLEQSQKGGDYDNEIQKIMHQEQNNVERTKQKQNMRRENKQKSEEQEQIKEQK
QQEMMQKVVYPFTEKDQEQQKLSVFTAEKFGEIEQIHPKVVQALQESNYETMTKIQKEGI
PQILKKENIALKSETGSGKTLTYLVPIISNLVHMGTDQKITREDGSYVFVICPTRELCIQ
CEEVAQLVTKKSKYLITGCLMGGENPKKEKARLRKGVTILFATPGRLLYHLKNTNSFLFS
KLKYIVFEESDRTLDMGFKKDLEEIVEQLTQKVSFEEVQKILISANFNDSVESLYLKMST
QTIKYVGFAKQKRNKADGPINYEEEKKHIKGDDMFKVPDTLIQYYSLINEEHRVPFLVSY
LSMLQDTKSIIFVSTCDEVDYFAFLFDAMRYKDANGEVQQDDQVLKQKIFKLHGNIEQRT
RSETYFSFKRYQGGAILISTDVASRGLDFYEVTHTILFDVPTSISEYCNRIGRTARIDQK
GISLLILNNVERPYVDKMKKYGIKLNKFDDEPVLDKVQREIKQKYDVGMDTMHYVESLIR
QSIRDDKTKYILARRAYVSSLRAYARLKDKDIFRVKKLNLHLIAKGFGLSGVKAGNETTS
KQYQHELVEANKNRYDKMEKFFMERLEKTAPKRKAMNSKKLFNMEFM


>TTHERM_00455140(gene)
ATGGATGACGATATTATGATTAACTTTGGTGATTTTGCACCTAAAAAAGTAGCTGATCCT
AGCAAAAACGAAACATAGGCACGTAGAGAAAAGTATAAGCAAAAGGCATTTGAACAAAAA
ACAAATTATAAAAATTTCCTCAAGAGATAAAGAGAAAAAACTTAACAAAATAGCGACGAC
ATAGAATAAGGCAATGTTTTAAAAGTTAAAAAGCCTATCTCTAAGAACCAAGATTTTAAA
AAAAGTACAAACAGGACGATTCCAAAGTTAGCAGAAGTCACTTGCTGCGAAGAAAATAAT
CCTGAATAGCAAGCTGACAACAAACAAGAAAACCAATAAGATTCTACAAAGCAAAATAAG
TTTAAGAAAGACTTCAAGTAATACTTGGAATAATCTTAAAAGGGAGGAGATTATGATAAC
GAAATATAAAAGATTATGCATTAGGAATAAAATAATGTTGAGCGTACTAAATAAAAGTAA
AATATGAGACGTGAAAACAAATAAAAAAGTGAAGAATAAGAGCAAATAAAGGAGTAAAAG
TAATAGGAAATGATGCAAAAAGTTGTTTATCCTTTCACTGAAAAAGATTAAGAATAGTAA
AAGCTCTCCGTCTTCACAGCTGAGAAATTCGGAGAAATAGAGTAAATTCATCCTAAAGTT
GTCTAAGCCTTACAAGAAAGCAACTACGAAACAATGACTAAAATTTAAAAAGAAGGTATT
CCTTAGATTTTAAAAAAAGAAAATATCGCTTTGAAGAGTGAAACAGGTTCTGGTAAAACT
TTAACTTATTTGGTTCCTATTATTTCGAATCTTGTCCACATGGGTACTGATCAAAAGGTA
AACTTTATTTTATTTATTTATCTTTGAATTATATTTGAATTAAAATGTTATAAAGATTAC
TAGAGAAGATGGTAGCTATGTTTTTGTAATTTGCCCTACTAGAGAATTGTGCATTTAGTG
CGAAGAAGTTGCGCAATTAGTTACTAAAAAATCAAAATATTTGATTACAGGTTGCTTGAT
GGGAGGTGAAAATCCTAAAAAAGAAAAAGCTAGATTAAGAAAAGGAGTAACCATCCTATT
TGCCACACCTGGTAGATTGCTATATCACCTCAAAAATACTAATTCCTTCTTGTTTAGCAA
GCTCAAGTACATTGTTTTCGAAGAATCTGATAGAACATTAGATATGGGTTTCAAGAAAGA
TTTAGAAGAAATCGTAGAATAGCTTACATAGAAAGTCTCCTTCGAGGAAGTATAAAAAAT
TCTTATTTCAGCTAACTTCAATGACAGTGTAGAAAGTCTTTACTTGAAGATGTCTACCTA
GACTATCAAATACGTTGGATTTGCTAAGCAAAAGAGGTATGCATTTCTTTATCTTTTATA
CAAAATAATTTTTTTTAAAATTCATTTTAGAAATAAAGCAGATGGACCAATAAACTATGA
AGAAGAAAAGAAACATATAAAGGGAGATGACATGTTCAAAGTCCCAGATACATTGATTTA
GTATTATTCTTTGATAAATGAAGAGCACAGAGTACCATTTTTAGTATCTTACCTTAGCAT
GCTTTAGGATACTAAATCTATTATTTTCGTATCAACTTGTGACGAAGTTGATTATTTTGC
TTTCCTTTTCGATGCAATGAGGTATAAGGATGCTAACGGTGAAGTATAGTAGGATGATTA
GGTTTTAAAATAAAAGATATTTAAGCTACATGGTAATATAGAGCAAAGGACTCGTAGTGA
AACTTACTTTTCTTTCAAGAGATACTAGGGAGGAGCTATCCTCATTTCAACAGATGTAGC
CAGTAGAGGTTTAGATTTTTACGAAGTAACTCACACTATTTTATTCGATGTACCCACTAG
CATCAGTGAGTATTGTAATAGAATTGGTAGAACTGCACGTATAGATTAAAAGGGTATTTC
TTTACTCATTTTGAATAATGTAGAAAGACCCTATGTTGATAAAATGAAAAAATATGGAAT
TAAATTGAACAAATTCGATGACGAGCCTGTTCTTGACAAAGTATAAAGAGAAATCAAATA
AAAGTATGATGTCGGTATGGATACTATGCACTATGTAGAAAGTTTAATTAGGTAATCTAT
AAGAGACGATAAAACTAAATATATATTAGCTCGTAGAGCTTATGTAAGTAGCTTAAGAGC
TTATGCCAGACTCAAAGACAAAGATATATTCCGTGTCAAAAAACTTAATTTACATTTAAT
AGCCAAGGGATTCGGTTTAAGTGGAGTCAAGGCTGGCAATGAAACTACCTCCAAGCAATA
TCAACATGAACTTGTTGAAGCTAATAAGAATAGATATGATAAGATGGAGAAATTCTTTAT
GGAAAGATTAGAAAAAACAGCTCCTAAGAGAAAAGCAATGAACTCTAAAAAATTATTTAA
TATGGAATTCATGTGA