Identifiers and Description

Gene Model Identifier

TTHERM_00036980

Standard Name

DRH6 (DExD/H box RNA helicase 6)

Aliases

PreTt14433 | 2.m02154 | 3825.m02806

Description

DRH6 type III restriction enzyme res subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.5%

TetraMine Data

TTHERM_00036980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00959.19.997093137033517e-262type III restriction enzyme, r
es subunit protein (439 aa)
OxytrichaContig12363.0.g657.998157153133101e-120DEAD/DEAH box helicase
DictyBaseDDB_G02703961.0001900614163146e-108ddx49 on chromosome: 1 positio
n 4752654 to 4754329
WormBaseWBGene000120597.996627236682682e-106Putative ATP-dependent RNA hel
icase T26G10.1 status:Confir
med UniProt:P34580 protein
_id:CAA82362.1
SGDYHR065C3.000425225396195e-97RRP3 Protein involved in rRNA
processing; required for matur
ation of the 35S primary trans
cript of pre-rRNA and for clea
vage leading to mature 18S rRN
A; homologous to eIF-4a, which
is a DEAD box RNA-dependent A
TPase with helicase activity
Stentor CoeruleusSteCoe_164501.5007857627073948e-41

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00036980(coding)
ATGCATCCATTTGCAAAGTTAGGATTAGACTCATGGATTTAGAAAACATGTGATAAAGTT
GGATATTAAAATCCTACTAAGATTTAGGAATTAGCTATTCCTCCTCTACTAAGAAAGCAA
CATGTTATTGCTAACGCAGAAACTGGTAGTGGTAAAACAGCTACTTTTGCTTTCCCTATT
TTGTAAGATTTAGCAAAAGATCCATTTGGTGTTTTCGCAATAGTTTTAACAGCAAACAGA
GAATTGGCTATGCAAATTTCTGAACAATTCACAATATTCGGAAGCTCTTTAAATTTAAGA
GTCTCCACTTTAGTTGGAGGAGTAGATTTTAATAAATAATTGTCTGAGTTAGAGAGAATT
CCTCATATTGTTGTAGGTACTCCTGGAAGAACATTAGATATGATTGATAAGTCTCCAGTT
CTAAAAGAATATATTGAAAATGTTAAATATTTAGTTTTGGACGAAGCTGATAGACTTTTT
GAGGATTCTATTATTGAAGATATATAATCAATTTTAGAGTTTATACCATAAGAGAAATAA
ATTATTCTAGCTACTGCTACTATAAATGATGACTTTAATGATAAAAAGTTAAACGAAATA
TTAAAAACTAATGTGAAATTTGAGAGATTCTGTGTAAACCAATAAAAAAAAGTAGTTCAA
ACATTAAAGCAAAAATTCGTCTTAGTCCCAGAAATGGTGAAAGATTAAAATTTCATCAAT
TTATTGAATAAATTCAAAGGAATTAGTATGATAATATTTGTAAATAAATGCAGAACTTGC
CATTTTATTAATGCTTTGTTGAATTAGTTAGAATTTTCATCTACTAGCTTGCATTCTGGT
TTAAAATAGGGATAAAGAATATCACACTTAAAGACTTTTAAAAGCCAAGCTGCAAATATT
TTAGTTGCTACAGATGTAGCTTCTAGAGGTTTAGATATACCTACAGTTGACTTAGTTATT
AATTATGATATACCTAAAAATTCTGATGATTATATTCACAGAGTAGGTAGAACTGCTCGT
AAAGGTAAAAGAGGTCTTGCTATTTCAATCATGACACAATATGATGTACAGCTTATTCTC
AATATAGAAAAAAATATCGGTGAAAAATTAGAAGAATTAAAAGTAGATGAAGAAGAAGCA
CTTGAAATAGCTCCTAAAGTTAACAAAGCTAAAAAGTTTGTTAAAATTAAAATGTCTGAA
GATGGTAGCTCTGAAAACTTTGACAAACAAGAACAAGATAAAAAAAGTTACAAAGAATTC
ATAAGAGAATAAAAAAAGCTAAAAAAGGTTGAAAATAACAAAATATAAGAAGAAAAATAA
TGA


>TTHERM_00036980(protein)
MHPFAKLGLDSWIQKTCDKVGYQNPTKIQELAIPPLLRKQHVIANAETGSGKTATFAFPI
LQDLAKDPFGVFAIVLTANRELAMQISEQFTIFGSSLNLRVSTLVGGVDFNKQLSELERI
PHIVVGTPGRTLDMIDKSPVLKEYIENVKYLVLDEADRLFEDSIIEDIQSILEFIPQEKQ
IILATATINDDFNDKKLNEILKTNVKFERFCVNQQKKVVQTLKQKFVLVPEMVKDQNFIN
LLNKFKGISMIIFVNKCRTCHFINALLNQLEFSSTSLHSGLKQGQRISHLKTFKSQAANI
LVATDVASRGLDIPTVDLVINYDIPKNSDDYIHRVGRTARKGKRGLAISIMTQYDVQLIL
NIEKNIGEKLEELKVDEEEALEIAPKVNKAKKFVKIKMSEDGSSENFDKQEQDKKSYKEF
IREQKKLKKVENNKIQEEKQ


>TTHERM_00036980(gene)
ATGCATCCATTTGCAAAGTTAGGATTAGACTCATGGATTTAGAAAACATGTGATAAAGTT
GGATATTAAAATCCTACTAAGATTTAGGAATTAGCTATTCCTCCTCTACTAAGAAAGCAA
CATGTTATTGGTAATTATTATAAATTAAAAAATATTATAAAAGCTTGAAATAGTTTTTAG
ATTAAAGCAAATTTCATTATGAGGTTTTATTAATACAATTTAAATTTAAAACTAATTTAG
CTAACGCAGAAACTGGTAGTGGTAAAACAGCTACTTTTGCTTTCCCTATTTTGTAAGATT
TAGCAAAAGATCCATTTGGTGTTTTCGCAATAGTTTTAACAGCAAACAGAGAATTGGCTA
TGCAAATTTCTGAACAATTCACAATATTCGGAAGCTCTTTAAATTTAAGAGTCTCCACTT
TAGTTGGAGGAGTAGATTTTAATAAATAATTGTCTGAGTTAGAGAGAATTCCTCATATTG
TTGTAGGTACTCCTGGAAGAACATTAGATATGATTGATAAGTCTCCAGTTCTAAAAGAAT
ATATTGAAAATGTTAAATATTTAGTTTTGGACGAAGCTGATAGACTTTTTGAGGATTCTA
TTATTGAAGATATATAATCAGTAAATTTTAGTTTAAGGCATAGCATTTAATTCATATTTT
TAATGATAAAAAGATTTTAGAGTTTATACCATAAGAGAAATAAATTATTCTAGCTACTGC
TACTATAAATGATGACTTTAATGATAAAAAGTTAAACGAAATATTAAAAACTAATGTGAA
ATTTGAGAGATTCTGTGTAAACCAATAAAAAAAAGTAGTTCAAACATTAAAGCAAGTAAC
TTATTTATTTATTTATATTTTAAAAATAAATAGTGATTTATTGATTATTCATTCTTAGAT
AAAGCATTTTACATTATAGAGTGTGAACTTAATTATAATTTAATCAATTACTATGATAAT
CATGCAATTTTCTAAAATTATTTATTAAAAAAAGAAATTCGTCTTAGTCCCAGAAATGGT
GAAAGATTAAAATTTCATCAATTTATTGAATAAATTCAAAGGAATTAGTATGATAATATT
TGTAAATAAATGCAGAACTTGCCATTTTATTAATGCTTTGTTGAATTAGTTAGAATTTTC
ATCTACTAGCTTGCATTCTGGTTTAAAATAGGGATAAAGAATATCACACTTAAAGACTTT
TAAAAGCCAAGCTGCAAATATTTTAGTTGCTACAGATGTAGCTTCTAGAGGTTTAGATAT
ACCTACAGTTGACTTAGTTATTAATTATGATATACCTAAAAATTCTGATGATTATATTCA
CAGAGTAGGTAGAACTGCTCGTAAAGGTAAAAGAGGTCTTGCTATTTCAATCATGACACA
ATATGATGTACAGCTTATTCTCAATATAGAAAAAAATATCGGTGAAAAATTAGAAGAATT
AAAAGTAGATGAAGAAGAAGCACTTGAAATAGCTCCTAAAGTTAACAAAGCTAAAAAGTT
TGTTAAAATTGTAAGCAATTAAATTTTTTGAAATATTATTAATAATTTTTTTAATAAGAA
AATGTCTGAAGATGGTAGCTCTGAAAACTTTGACAAACAAGAACAAGATAAAAAAAGTTA
CAAAGAATTCATAAGAGAATAAAAAAAGCTAAAAAAGGTTGAAAATAACAAAATATAAGA
AGAAAAATAATGA