Identifiers and Description

Gene Model Identifier

TTHERM_00036980

Standard Name

DRH6 (DExD/H box RNA helicase 6)

Aliases

PreTt14433 | 2.m02154 | 3825.m02806

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.5%

TetraMine Data

TTHERM_00036980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00959.19.997093137033517e-262type III restriction enzyme, r
es subunit protein (439 aa)
OxytrichaContig12363.0.g657.998157153133101e-120DEAD/DEAH box helicase
DictyBaseDDB_G02703961.0001900614163146e-108ddx49 on chromosome: 1 positio
n 4752654 to 4754329
WormBaseWBGene000120597.996627236682682e-106Putative ATP-dependent RNA hel
icase T26G10.1 status:Confir
med UniProt:P34580 protein
_id:CAA82362.1
SGDYHR065C3.000425225396195e-97RRP3 Protein involved in rRNA
processing; required for matur
ation of the 35S primary trans
cript of pre-rRNA and for clea
vage leading to mature 18S rRN
A; homologous to eIF-4a, which
is a DEAD box RNA-dependent A
TPase with helicase activity
Stentor CoeruleusSteCoe_164501.5007857627073948e-41

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00036980(coding)
ATGCATCCATTTGCAAAGTTAGGATTAGACTCATGGATTTAGAAAACATGTGATAAAGTT
GGATATTAAAATCCTACTAAGATTTAGGAATTAGCTATTCCTCCTCTACTAAGAAAGCAA
CATGTTATTGCTAACGCAGAAACTGGTAGTGGTAAAACAGCTACTTTTGCTTTCCCTATT
TTGTAAGATTTAGCAAAAGATCCATTTGGTGTTTTCGCAATAGTTTTAACAGCAAACAGA
GAATTGGCTATGCAAATTTCTGAACAATTCACAATATTCGGAAGCTCTTTAAATTTAAGA
GTCTCCACTTTAGTTGGAGGAGTAGATTTTAATAAATAATTGTCTGAGTTAGAGAGAATT
CCTCATATTGTTGTAGGTACTCCTGGAAGAACATTAGATATGATTGATAAGTCTCCAGTT
CTAAAAGAATATATTGAAAATGTTAAATATTTAGTTTTGGACGAAGCTGATAGACTTTTT
GAGGATTCTATTATTGAAGATATATAATCAATTTTAGAGTTTATACCATAAGAGAAATAA
ATTATTCTAGCTACTGCTACTATAAATGATGACTTTAATGATAAAAAGTTAAACGAAATA
TTAAAAACTAATGTGAAATTTGAGAGATTCTGTGTAAACCAATAAAAAAAAGTAGTTCAA
ACATTAAAGCAAAAATTCGTCTTAGTCCCAGAAATGGTGAAAGATTAAAATTTCATCAAT
TTATTGAATAAATTCAAAGGAATTAGTATGATAATATTTGTAAATAAATGCAGAACTTGC
CATTTTATTAATGCTTTGTTGAATTAGTTAGAATTTTCATCTACTAGCTTGCATTCTGGT
TTAAAATAGGGATAAAGAATATCACACTTAAAGACTTTTAAAAGCCAAGCTGCAAATATT
TTAGTTGCTACAGATGTAGCTTCTAGAGGTTTAGATATACCTACAGTTGACTTAGTTATT
AATTATGATATACCTAAAAATTCTGATGATTATATTCACAGAGTAGGTAGAACTGCTCGT
AAAGGTAAAAGAGGTCTTGCTATTTCAATCATGACACAATATGATGTACAGCTTATTCTC
AATATAGAAAAAAATATCGGTGAAAAATTAGAAGAATTAAAAGTAGATGAAGAAGAAGCA
CTTGAAATAGCTCCTAAAGTTAACAAAGCTAAAAAGTTTGTTAAAATTAAAATGTCTGAA
GATGGTAGCTCTGAAAACTTTGACAAACAAGAACAAGATAAAAAAAGTTACAAAGAATTC
ATAAGAGAATAAAAAAAGCTAAAAAAGGTTGAAAATAACAAAATATAAGAAGAAAAATAA
TGA


>TTHERM_00036980(protein)
MHPFAKLGLDSWIQKTCDKVGYQNPTKIQELAIPPLLRKQHVIANAETGSGKTATFAFPI
LQDLAKDPFGVFAIVLTANRELAMQISEQFTIFGSSLNLRVSTLVGGVDFNKQLSELERI
PHIVVGTPGRTLDMIDKSPVLKEYIENVKYLVLDEADRLFEDSIIEDIQSILEFIPQEKQ
IILATATINDDFNDKKLNEILKTNVKFERFCVNQQKKVVQTLKQKFVLVPEMVKDQNFIN
LLNKFKGISMIIFVNKCRTCHFINALLNQLEFSSTSLHSGLKQGQRISHLKTFKSQAANI
LVATDVASRGLDIPTVDLVINYDIPKNSDDYIHRVGRTARKGKRGLAISIMTQYDVQLIL
NIEKNIGEKLEELKVDEEEALEIAPKVNKAKKFVKIKMSEDGSSENFDKQEQDKKSYKEF
IREQKKLKKVENNKIQEEKQ


>TTHERM_00036980(gene)
ATGCATCCATTTGCAAAGTTAGGATTAGACTCATGGATTTAGAAAACATGTGATAAAGTT
GGATATTAAAATCCTACTAAGATTTAGGAATTAGCTATTCCTCCTCTACTAAGAAAGCAA
CATGTTATTGGTAATTATTATAAATTAAAAAATATTATAAAAGCTTGAAATAGTTTTTAG
ATTAAAGCAAATTTCATTATGAGGTTTTATTAATACAATTTAAATTTAAAACTAATTTAG
CTAACGCAGAAACTGGTAGTGGTAAAACAGCTACTTTTGCTTTCCCTATTTTGTAAGATT
TAGCAAAAGATCCATTTGGTGTTTTCGCAATAGTTTTAACAGCAAACAGAGAATTGGCTA
TGCAAATTTCTGAACAATTCACAATATTCGGAAGCTCTTTAAATTTAAGAGTCTCCACTT
TAGTTGGAGGAGTAGATTTTAATAAATAATTGTCTGAGTTAGAGAGAATTCCTCATATTG
TTGTAGGTACTCCTGGAAGAACATTAGATATGATTGATAAGTCTCCAGTTCTAAAAGAAT
ATATTGAAAATGTTAAATATTTAGTTTTGGACGAAGCTGATAGACTTTTTGAGGATTCTA
TTATTGAAGATATATAATCAGTAAATTTTAGTTTAAGGCATAGCATTTAATTCATATTTT
TAATGATAAAAAGATTTTAGAGTTTATACCATAAGAGAAATAAATTATTCTAGCTACTGC
TACTATAAATGATGACTTTAATGATAAAAAGTTAAACGAAATATTAAAAACTAATGTGAA
ATTTGAGAGATTCTGTGTAAACCAATAAAAAAAAGTAGTTCAAACATTAAAGCAAGTAAC
TTATTTATTTATTTATATTTTAAAAATAAATAGTGATTTATTGATTATTCATTCTTAGAT
AAAGCATTTTACATTATAGAGTGTGAACTTAATTATAATTTAATCAATTACTATGATAAT
CATGCAATTTTCTAAAATTATTTATTAAAAAAAGAAATTCGTCTTAGTCCCAGAAATGGT
GAAAGATTAAAATTTCATCAATTTATTGAATAAATTCAAAGGAATTAGTATGATAATATT
TGTAAATAAATGCAGAACTTGCCATTTTATTAATGCTTTGTTGAATTAGTTAGAATTTTC
ATCTACTAGCTTGCATTCTGGTTTAAAATAGGGATAAAGAATATCACACTTAAAGACTTT
TAAAAGCCAAGCTGCAAATATTTTAGTTGCTACAGATGTAGCTTCTAGAGGTTTAGATAT
ACCTACAGTTGACTTAGTTATTAATTATGATATACCTAAAAATTCTGATGATTATATTCA
CAGAGTAGGTAGAACTGCTCGTAAAGGTAAAAGAGGTCTTGCTATTTCAATCATGACACA
ATATGATGTACAGCTTATTCTCAATATAGAAAAAAATATCGGTGAAAAATTAGAAGAATT
AAAAGTAGATGAAGAAGAAGCACTTGAAATAGCTCCTAAAGTTAACAAAGCTAAAAAGTT
TGTTAAAATTGTAAGCAATTAAATTTTTTGAAATATTATTAATAATTTTTTTAATAAGAA
AATGTCTGAAGATGGTAGCTCTGAAAACTTTGACAAACAAGAACAAGATAAAAAAAGTTA
CAAAGAATTCATAAGAGAATAAAAAAAGCTAAAAAAGGTTGAAAATAACAAAATATAAGA
AGAAAAATAATGA