Identifiers and Description

Gene Model Identifier

TTHERM_00991620

Standard Name

DRH5 (DExD/H box RNA helicase 5)

Aliases

PreTt07854 | 185.m00075

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF06519 ) TolA protein
  • ( TIGR02794 ) protein TolA
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF08648 ) Protein of unknown function (DUF1777)
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00991620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02912.19.997093137033517e-262DEAD/DEAH box helicase (738 aa
)
OxytrichaContig7238.0.g679.997093137033517e-262DEAD/DEAH box helicase
WormBaseWBGene000171622.0007442334946695e-153locus:ddx-23 status:Confirme
d UniProt:Q95QN2 protein_i
d:CCD65989.1
DictyBaseDDB_G02778574.000899569014317e-153helB2 on chromosome: 3 positio
n 776296 to 778895
SGDYDR243C4.001158060863534e-95PRP28 RNA helicase in the DEAD
-box family, involved in RNA i
somerization at the 5 splice s
ite
Stentor CoeruleusSteCoe_86105.0345753587649823e-45

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00991620(coding)
ATGATCGAAGAGGAATATTTTAGCGAAGAAGAAGAAAATCAATAACAGCAATAAACTAAA
TAGCCGGAGGAAAATTCTTGGCGCCCTACACAAACAGAGACATAGGAAGAATAAACTAAT
GCTGCAGCTTTAGAAAGCGAACAACATGAATAAACAAATTAGAAGTAATAGATTCAATTA
GTCTACATGAGCAGAGCTGAAAGAGAGAAACTAAGATAAAAAGAGGAAGAAGATAGGAAA
AAGCGTGAATAGTAAAAGCTGAAATAGGAAAAGCAAATTAGAGAAGAATATGAAAAGTTT
AAATACAAAGAATGGAAGAGAGAATAGGAAAGGGAAGAAAGAAAGAGAGAAAGAGAATAA
AAAGAGAGGGAAGAAAAAGAAAAAAGAATGAGAGAAAAAAGCAAGTCTCGTTCTAGATCT
AGATCTGACAGTAGAGATAGAGATTCGAAGTATATGACTTCCAACACTAGAGCAACTGAA
AAAATAGCAATTATAAATTCTACTGAAGACCCAGAAATTCAAAATATTAAAATACAATAT
TTGGGTTTGAACAAAGAGAAAAAGAAGATTTTAAAGCCATCTGAAAAATTCAAAAATATA
TTTAATTTTAAATGGGATAGCAGTGACGATACTTCTGTCGATTTTAATCCTTTATACAAA
AATAAGATCCAGTCTAATTTCTTGTTTGGTAGAGGTATTTAAGCTGGTTATGATGTCAAA
GAGTAGCTAGAAAAGAATGTTAAGTATGAAGATTTGATCCACAAATTTGATCCTGAGTAC
TAGAAAAAGAAATAGGAAAATAAGGATAAAGATAAAGATAAAGATACAAAGAGAAGCATT
TACGATGTAACCACTAAAGACCATTGGTCATAGAAAAAATTTGATGAAATGACAGAAAGA
GATTGGCGTATTTTTAGAGAAGATAACGATATTATTATAAAGGGTGGCAGAGTTCCTAAG
CCTATGAGAACTTGGGAAGAAGGTGAACTCCCTCCTTACATATTAGATGCTGTCAGAAGA
TCAAAATATGAAAAACCAACTCCAATTTAAATGCAAACCATACCAATTGGTTTGTAAAGA
AAAGATCTGATTGGTATTTCCTAAACTGGTACAGGTAAAACTTGTGCTTTCCTCATACCT
TTAATTACATACTTGAGAAGTTTACCTCCGATGGATGAAGAAATAGCTAAAGATGGTCCT
TATGCTCTTATTTTAATTCCTACAAGAGAACTTGCTCCTTAAATCGAAAAAGAATTCTAA
AATTTGACTTCGAATATGAGAATGAAGAGTTTAGTTATGGTTGGTGGTAAGGATGAAGGA
AACCAAGCATTTAAGCTAAAATTGGGTTGTGAACTTCTTATCGGTACAGTAGGTAGAATT
AAAGATGCTCTTGAAAAAAATTATCTCGTTTTAGATTAAGTCTCTTGGGTAGTATTGGAT
GAAGCAGATAAAATGATTGATCTCAATTTTGAACAAGATGTCAACTTCATTTTAGATAAG
ATTCGCACAAATATGAAGAGTGAAGATGAAAATATGGCTGTTTTATAAGAGTAGGAAGCA
AAGGTTGGTGAAAAAATATTTAGAGTAACTCACTTGTTTAGTGCTACTATGCCTCCTAAT
TTAGAAAGACTTGCTAAAAAGTATTTAAGATCTTTTTGCTATATCAGTATTGGTGAAGCT
GGAGATGCCAAAAAGGATATTGAACAAATAGTTGATTTCATGTCAGAGGGTTAAAAGAAA
TCAAGACTTCAAAAAATTTTAGAAACGGCCAAACCTCCTATTATTATTTTTGCTAACGAA
AAGACAGCCGTAGAAAAGTTATCAAAGATTTTAGATAGATGGGGATGGTAAAATGTTATC
TATCATGGTGGTAAGACTCAATAATAAAGAGAAGCAGCTGTTGATGGATTCAAAAAAGGA
AAATATGATATTCTTGTTGCTACAGATCTTGGTGCTAGAGGTCTCCACGTTGATGGAGTT
AAGATGGTTATTAACTTTGATGCTCCCAAAAATATAAAAGATTTCATTCACAGAACAGGT
AGAACTGGTAGAGCAGGAAAACGTGGTATTGCTTACACATTCGTTACTAATCATAATGAA
GCAATTATGTATGATTTAAGAGAGTTCTTATTCAAAAATAATTTTGATATCCCTTCAGAA
CTCGATACTCACCCAGCTGCTCAAACAAAGCCAGGAACTATTTCTGAAAACGTTCCTCGT
AGTCAGTAAGTAATTTTAGCCTAGTAATGA


>TTHERM_00991620(protein)
MIEEEYFSEEEENQQQQQTKQPEENSWRPTQTETQEEQTNAAALESEQHEQTNQKQQIQL
VYMSRAEREKLRQKEEEDRKKREQQKLKQEKQIREEYEKFKYKEWKREQEREERKREREQ
KEREEKEKRMREKSKSRSRSRSDSRDRDSKYMTSNTRATEKIAIINSTEDPEIQNIKIQY
LGLNKEKKKILKPSEKFKNIFNFKWDSSDDTSVDFNPLYKNKIQSNFLFGRGIQAGYDVK
EQLEKNVKYEDLIHKFDPEYQKKKQENKDKDKDKDTKRSIYDVTTKDHWSQKKFDEMTER
DWRIFREDNDIIIKGGRVPKPMRTWEEGELPPYILDAVRRSKYEKPTPIQMQTIPIGLQR
KDLIGISQTGTGKTCAFLIPLITYLRSLPPMDEEIAKDGPYALILIPTRELAPQIEKEFQ
NLTSNMRMKSLVMVGGKDEGNQAFKLKLGCELLIGTVGRIKDALEKNYLVLDQVSWVVLD
EADKMIDLNFEQDVNFILDKIRTNMKSEDENMAVLQEQEAKVGEKIFRVTHLFSATMPPN
LERLAKKYLRSFCYISIGEAGDAKKDIEQIVDFMSEGQKKSRLQKILETAKPPIIIFANE
KTAVEKLSKILDRWGWQNVIYHGGKTQQQREAAVDGFKKGKYDILVATDLGARGLHVDGV
KMVINFDAPKNIKDFIHRTGRTGRAGKRGIAYTFVTNHNEAIMYDLREFLFKNNFDIPSE
LDTHPAAQTKPGTISENVPRSQQVILAQQ


>TTHERM_00991620(gene)
ATGATCGAAGAGGAATATTTTAGCGAAGAAGAAGAAAATCAATAACAGCAATAAACTAAA
TAGCCGGAGGAAAATTCTTGGCGCCCTACACAAACAGAGACATAGGAAGAATAAACTAAT
GCTGCAGCTTTAGAAAGCGAACAACATGAATAAACAAATTAGAAGTAATAGATTCAATTA
GTCTACATGAGCAGAGCTGAAAGAGAGAAACTAAGATAAAAAGAGGAAGAAGATAGGAAA
AAGCGTGAATAGTAAAAGCTGAAATAGGAAAAGCAAATTAGAGAAGAATATGAAAAGTTT
AAATACAAAGAATGGAAGAGAGAATAGGAAAGGGAAGAAAGAAAGAGAGAAAGAGAATAA
AAAGAGAGGGAAGAAAAAGAAAAAAGAATGAGAGAAAAAAGCAAGTCTCGTTCTAGATCT
AGATCTGACAGTAGAGATAGAGATTCGAAGTATATGACTTCCAACACTAGAGCAACTGAA
AAAATAGCAATTATAAATTCTACTGAAGACCCAGAAATTCAAAATATTAAAATACAATAT
TTGGGTTTGAACAAAGAGAAAAAGAAGATTTTAAAGCCATCTGAAAAATTCAAAAATATA
TTTAATTTTAAATGGGATAGCAGTGACGATACTTCTGTCGATTTTAATCCTTTATACAAA
AATAAGATCCAGTCTAATTTCTTGTTTGGTAGAGGTATTTAAGCTGGTTATGATGTCAAA
GAGTAGCTAGAAAAGAATGTTAAGTATGAAGATTTGATCCACAAATTTGATCCTGAGTAC
TAGAAAAAGAAATAGGAAAATAAGGATAAAGATAAAGATAAAGATACAAAGAGAAGCATT
TACGATGTAACCACTAAAGACCATTGGTCATAGAAAAAATTTGATGAAATGACAGAAAGA
GATTGGCGTATTTTTAGAGAAGATAACGATATTATTATAAAGGGTGGCAGAGTTCCTAAG
CCTATGAGAACTTGGGAAGAAGGTGAACTCCCTCCTTACATATTAGATGCTGTCAGAAGA
TCAAAATATGAAAAACCAACTCCAATTTAAATGCAAACCATACCAATTGGTAATAAAATT
AATTTTATTTATTTAAAACAATTCGTTTAAATCATTTTTATTCAATCTTAAATTTTAATA
TTTAAATAAATAAATAAATAAATAAATAGGTTTGTAAAGAAAAGATCTGATTGGTATTTC
CTAAACTGGTACAGGTAAAACTTGTGCTTTCCTCATACCTTTAATTACATACTTGAGAAG
TTTACCTCCGATGGATGAAGAAATAGCTAAAGATGGTCCTTATGCTCTTATTTTAATTCC
TACAAGAGAACTTGCTCCTTAAATCGAAAAAGAATTCTAAAATTTGACTTCGAATATGAG
AATGAAGAGTTTAGTTATGGTTGGTGGTAAGGATGAAGGAAACCAAGCATTTAAGCTAAA
ATTGGGTTGTGAACTTCTTATCGGTACAGTAGGTAGAATTAAAGATGCTCTTGAAAAAAA
TTATCTCGTTTTAGATTAAGTCTCTTGGGTAGTATTGGATGAAGCAGATAAAATGATTGA
TCTCAATTTTGAACAAGATGTCAACTTCATTTTAGATAAGTAAAAAAAATTATTATTAAA
CAAATTTAATTAAATAAAAAAGTAAAATAACATTTTAATAAACTAATTTTATGAAGAAAT
AGCTTTTCTTTATTAATAAAGACTAGATTATTTTTAAATTAGATTAAATTTTTTTTAATT
TTAAATTAATTTTTATTTAAATTTAAGGATTCGCACAAATATGAAGAGTGAAGATGAAAA
TATGGCTGTTTTATAAGAGTAGGAAGCAAAGGTTGGTGAAAAAATATTTAGAGTAACTCA
CTTGTTTAGTGCTACTATGCCTCCTAATTTAGAAAGACTTGCTAAAAAGTATTTAAGATC
TTTTTGCTATATCAGTATTGGTGAAGCTGGAGATGCCAAAAAGGATATTGAACAAATAGT
TGATTTCATGTCAGAGGGTTAAAAGAAATCAAGACTTCAAAAAATTTTAGAAACGGCCAA
ACCTCCTATTATTATTTTTGCTAACGAAAAGACAGCCGTAGAAAAGTTATCAAAGATTTT
AGATAGATGGGGAGTAATAAATTATTTTAATTTATTTATTAGAATAAAAAATTCTTTAAA
CGCAGTATTTAAAGGTGGAATGTTGTGAAAACTAAATTGATGTCTACATTCAAAATAAAT
ACTGCTACATTTATCAAAAATTACTTTTAATTGACAATTATTAAGTTGATTAAAATTAAC
TTCAATTTTTAATGAATTAATTTGTTTATTTATTTTAGATATTTATTCTTATTTATTATT
AATTAAAAGTGGTAAAATGTTATCTATCATGGTGGTAAGACTCAATAATAAAGAGAAGCA
GCTGTTGATGGATTCAAAAAAGGAAAATATGATATTCTTGTTGCTACAGATCTTGGTGCT
AGAGGTCTCCACGTTGATGGAGTTAAGATGGTTATTAACTTTGATGCTCCCAAAAATATA
AAAGATTTCATTCACAGAACAGGTAGAACTGGTAGAGCAGGAAAACGTGGTATTGCTTAC
ACATTCGTTACTAATCATAATGAAGCAATTATGTATGATTTAAGAGAGTTCTTATTCAAA
AATAATTTTGATATCCCTTCAGAACTCGATACTCACCCAGCTGCTCAAACAAAGCCAGGA
ACTATTTCTGAAAACGTTCCTCGTAGTCAGTAAGTAATTTTAGCCTAGTAATGA