Identifiers and Description

Gene Model Identifier

TTHERM_00579150

Standard Name

DRH45 (DExD/H box RNA helicase 45)

Aliases

PreTt05808 | 78.m00180 | 3733.m00075

Description

ATP-dependent RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR00161 ) conserved hypothetical protein TIGR00161

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00579150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16329.19.997093137033517e-262hypothetical protein (619 aa)
WormBaseWBGene000160732.9993110246221282e-28status:Confirmed UniProt:O17
157 protein_id:CCD62828.1
SGDYLR276C9.998720540547892e-23DBP9 ATP-dependent RNA helicas
e of the DEAD-box family invol
ved in biogenesis of the 60S r
ibosomal subunit
OxytrichaContig12468.0.g662.99851380290819e-19DEAD/DEAH box helicase
DictyBaseDDB_G02804074.0002685161515803e-16ddx56 on chromosome: 3 positio
n 3312082 to 3314385
Stentor CoeruleusSteCoe_80410.0000022603294069810542

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00579150(coding)
ATGGATATCACAGGTCGTTTAAATTAAGAAGTTTAGATTTAAGAATTACTAGAAGGCTGC
GATGAGAATTTAATAAAAGGTCTTGTCAAAAATAAAATAGTTCATCCCACTTTTTGTCAA
GAATAGTTGTTTAATCTCAATAAGGAGAGAGATCACATTGTCATTAGAAGTGGTATGGTT
TCTGGTAAAACAACCGGTTTGCTCATAGTCCTTCTCAATGATTTCATAAATAAAATGAAG
CAGTTTAAATTCGTTGAAGGAAATGAAACTGAAGATGAATCAGTTGGTTTATTCTCAGTC
CTCATCACTGCTTCTAAAGACTTAGCTTAAAAGAATCACAGTGTAGCTGAAAACATATGC
GCCTTCATCAAAAAGCCATACAACATGCAAGTTATGAATTTAAGCACATTCTCTGAAGAA
AATTTCACAATTATACCTAAAACTCACTACTTGATTGTTGCCACACCTTCTACTTTCTTG
AAATTTGCCAAGCATACTAAATTCGATAAAAAGAAATTCGTTAACTTTGCCTTTGATGAT
ATTGATTATATGCTTTCTTTTGGCTACAAAGGCGAATTAACCAACTTCTAATTTTTCTAT
GAATCTGAAATCAAGCAAGAAAACTTTAAGTGTTACTGGAGTGCAACAGAAGAATTAAAT
GATGATTTAAAGGAATTAAAAAAGACTTTCTTGCATAAAAGTGTTATAATTAATGTAGAT
GATGATTATGATGAAATGGATGATTAAGAAAGAAAGAGCAAGCAAGCTCTTTAGTTTGAT
CACGATTAAATTACTCATTACTATACAACAGGAGATGAAACAACTCAATATATAATCTTA
TACGTCTTATTCAAGTTACGTTTCCTTTAAGGAAAATCTTTAATCCTCTGTAGCGACCTA
GAAACTGTATACAAGGTTCATTTATATTTAGAAAGAATTGGTTAAACAGAAATGCAGTTA
TATAATCATGAAAATCCCAAAAATTTACGTTACTATATTGTAACACTTTTCAACACTGGT
ATGATTAAAACATTGGTTTCCACCAAGTAGTTGTTCTAGGATTTCAAGAATAAAGACTTT
TATGATAAAAAAATAAAAACAAACAGACTTAAGGGTATTAGAAATATTATAAATTTAGAT
TTACTTGATATTGGAGAGGAATATAATTAATTCTTCAAGCTCTTCAACGGTTAGACAGGA
AATATTTTCAACTTAGTCTTAAACGAAGAAAAGCAAATTGAAAACTTGATGAATCGTATT
GAATATGAAAAAGAAAATTTCAACAAAGTTAATTTCAAAGAATTTCCTCTTCGTCGTCAT
GAAATTGAAGCATTTAGATATAGAGTCAACAACGTTTATACTAGCTTAACCAAAAAATAA
ATAGCAAGTGCTAAAATGCTTGATTTTAAAAAGAAAATGCTTAAATCTCCTGATATGAAA
GAATATTATGCTAAAAATATTTCAGAAAAAGAATTGTTGATTGAAAGTATATAAAAGCTT
ACCAAGTAACTCAAAAAGCACGAAACAAGATGTGAAGGCGATGTACCCGATTATCTTTTA
CCTTAGTTCTTAATAGATTAAAAGAAAAGAGCAGAAGAACTTGATCCAAATGCAAACAAG
AAGGTCAAGAAAATTTTAGTTTACAAAGGTAGCAGCGGTTCTCAATAAGCAGATGAAGGC
AAAAAGAAAATGAGAGGTGATAAATACGTTTACATTAATGAAGAAAAAGAAAATGAAAAT
GAAACAGATGCCTCCAGATTAAAAATTTTATCAAGAAAGAAATAATGGAAGCTTCGTCAT
GGTTTTAAATTAAAAAGAGTTAATAAACGTTTAGAGAAGAAAGGTATTTTCTAATCTTGA


>TTHERM_00579150(protein)
MDITGRLNQEVQIQELLEGCDENLIKGLVKNKIVHPTFCQEQLFNLNKERDHIVIRSGMV
SGKTTGLLIVLLNDFINKMKQFKFVEGNETEDESVGLFSVLITASKDLAQKNHSVAENIC
AFIKKPYNMQVMNLSTFSEENFTIIPKTHYLIVATPSTFLKFAKHTKFDKKKFVNFAFDD
IDYMLSFGYKGELTNFQFFYESEIKQENFKCYWSATEELNDDLKELKKTFLHKSVIINVD
DDYDEMDDQERKSKQALQFDHDQITHYYTTGDETTQYIILYVLFKLRFLQGKSLILCSDL
ETVYKVHLYLERIGQTEMQLYNHENPKNLRYYIVTLFNTGMIKTLVSTKQLFQDFKNKDF
YDKKIKTNRLKGIRNIINLDLLDIGEEYNQFFKLFNGQTGNIFNLVLNEEKQIENLMNRI
EYEKENFNKVNFKEFPLRRHEIEAFRYRVNNVYTSLTKKQIASAKMLDFKKKMLKSPDMK
EYYAKNISEKELLIESIQKLTKQLKKHETRCEGDVPDYLLPQFLIDQKKRAEELDPNANK
KVKKILVYKGSSGSQQADEGKKKMRGDKYVYINEEKENENETDASRLKILSRKKQWKLRH
GFKLKRVNKRLEKKGIFQS


>TTHERM_00579150(gene)
ATGGATATCACAGGTCGTTTAAATTAAGAAGTTTAGATTTAAGAATTACTAGAAGGCTGC
GATGAGAATTTAATAAAAGGTCTTGTCAAAAATAAAATAGTTCATCCCACTTTTTGTCAA
GAATAGTTGTTTAATCTCAATAAGGAGAGAGATCACATTGTCATTAGAAGTGGTATGGTT
TCTGGTAAAACAACCGGTTTGCTCATAGTCCTTCTCAATGATTTCATAAATAAAATGAAG
CAGTTTAAATTCGTTGAAGGAAATGAAACTGAAGATGAATCAGTTGGTTTATTCTCAGTC
CTCATCACTGCTTCTAAAGACTTAGCTTAAAAGAATCACAGTGTAGCTGAAAACATATGC
GCCTTCATCAAAAAGCCATACAACATGCAAGTTATGAATTTAAGCACATTCTCTGAAGAA
AATTTCACAATTATACCTAAAACTCACTACTTGATTGTTGCCACACCTTCTACTTTCTTG
AAATTTGCCAAGCATACTAAATTCGATAAAAAGAAATTCGTTAACTTTGCCTTTGATGAT
ATTGATTATATGCTTTCTTTTGGCTACAAAGGCGAATTAACCAACTTCTAATTTTTCTAT
GAATCTGAAATCAAGTAAAATAAATATATTTTCTAAACTATTTATCTTTTATTTCCTTAC
ATTAGCGATGGAATCTATTTATTTGTATCTAATTTATCGTAAGTAAAATTAAAAACTATT
TTATTATTAAACAGGCAAGAAAACTTTAAGTGTTACTGGAGTGCAACAGAAGAATTAAAT
GATGATTTAAAGGAATTAAAAAAGACTTTCTTGCATAAAAGTGTTATAATTAATGTAGAT
GATGATTATGATGAAATGGATGATTAAGAAAGAAAGAGCAAGCAAGCTCTTTAGTTTGAT
CACGATTAAATTACTCATTACTATACAACAGGAGATGAAACAACTCAATATATAATCTTA
TACGTCTTATTCAAGTTACGTTTCCTTTAAGGAAAATCTTTAATCCTCTGTAGCGACCTA
GAAACTGTATACAAGGTAATTAAATCTATCTTACATTGCTTACTTTATATTTATTTTTAA
ATCATAAAACTATTTATTTGCTCATTTATTTAAGGAATTATCTTTTAATTTTGCAAGTCT
ATAATTAAAATTAGTAAAAGCATATTGAAAAATAGAAAAATTCTATTCAAAAATAATTAA
AAACTTTTTTATTGTGAGAAATTAATTTTAAAATTTTGTTAAAATAGGTTCATTTATATT
TAGAAAGAATTGGTTAAACAGAAATGCAGTTATATAATCATGAAAATCCCAAAAATTTAC
GTTACTATATTGTAACACTTTTCAACACTGGTATGATTAAAACATTGGTTTCCACCAAGT
AGTTGTTCTAGGATTTCAAGAATAAAGACTTTTATGATAAAAAAATAAAAACAAACAGAC
TTAAGGGTATTAGAAATATTATAAATTTAGATTTACTTGATATTGGAGAGGAATATAATT
AATTCTTCAAGCTCTTCAACGGTTAGACAGGAAATATTTTCAACTTAGTCTTAAACGAAG
AAAAGCAAATTGAAAACTTGATGAATCGTATTGAATATGAAAAAGAAAATTTCAACAAAG
TTAATTTCAAAGAATTTCCTCTTCGTCGTCATGAAATTGAAGCATTTAGGTAAATATAAA
TTGCATATATTTAAAAATTAATTTAAAATTATCTTAAAAAAAATAGATATAGAGTCAACA
ACGTTTATACTAGCTTAACCAAAAAATAAATAGCAAGTGCTAAAATGCTTGATTTTAAAA
AGAAAATGCTTAAATCTCCTGATATGAAAGAATATTATGCTAAAAATATTTCAGAAAAAG
AATTGTTGATTGAAAGTATATAAAAGCTTACCAAGTAACTCAAAAAGCACGAAACAAGAT
GTGAAGGCGATGTACCCGATTATCTTTTACCTTAGTTCTTAATAGATTAAAAGAAAAGAG
CAGAAGAACTTGATCCAAATGCAAACAAGAAGGTCAAGAAAATTTTAGTTTACAAAGGTA
GCAGCGGTTCTCAATAAGCAGATGAAGGCAAAAAGAAAATGAGAGGTGATAAATACGTTT
ACATTAATGAAGAAAAAGAAAATGAAAATGAAACAGATGCCTCCAGATTAAAAATTTTAT
CAAGAAAGAAATAATGGAAGCTTCGTCATGGTTTTAAATTAAAAAGAGTTAATAAACGTT
TAGAGAAGAAAGGTATTTTCTAATCTTGA