Identifiers and Description

Gene Model Identifier

TTHERM_00392950

Standard Name

DRH44 (DExD/H box RNA helicase 44)

Aliases

PreTt23523 | 42.m00257 | 3813.m01478

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00392950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11497.19.997093137033517e-262helicase domain-containing pro
tein (458 aa)
OxytrichaContig526.1.g1219.998720540547892e-23DEAD/DEAH box helicase
DictyBaseDDB_G02918049.000561397357242e-21ddx6 on chromosome: 6 position
773358 to 774746
SGDYDL084W1.9991095569230066e-20SUB2 Component of the TREX com
plex required for nuclear mRNA
export; member of the DEAD-bo
x RNA helicase superfamily and
is involved in early and late
steps of spliceosome assembly
; homolog of the human splicin
g factor hUAP56
WormBaseWBGene000102605.999654353873483e-20locus:ddx-17 status:Confirme
d UniProt:Q9XUW5 protein_i
d:CAB04518.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00392950(coding)
ATGAGCGATTAAGTAGAAGAAAAAAAAGATAACTAATCAGTAAATACAGTCATGACTGAA
GATATTAAGAAAGAGCATTTAAGAAGCATTGAGACAGATAAAACTTGGGATGATATTTTT
GCTTTGTCTCCTGAAGTGAGAGAAAGAATTAAACAAATTTACGAAAGGCCTACGAAGATT
TAATATTTGTCTATTGGAGAAACAATTGAATATATATAGCCAGTTATTACAATCAAGTGC
AGAAATGGTGGAGGTAAAACTCTTACTTTTGCTATTCCTGCTTTGGAATTTGCTTACAGA
AATAAAAATAAAAAGACTTCAAAATCCTAGCAATCAGTCTAAGAAGTTCATGGATAGAGT
TCCTAAACTGGAGCAACTGTTTACTGTCCTACATCGATTATTATTGTGTCAACATAGCCA
CTCGCTTTGCAAATTTAAAGCGTTTTAAATAATCTTTTGGTTGAAGGAGTTTCTACAGAA
GTTCTATTCTAAGACCAAAAGATTACTCAATCTGGTTAGATATTGATTTCCACTCCAGAG
CTACTTTACAGATACTTGGTGATAGAAAAGTTAATATAGTTAGATAATTTATGTCATATT
GCTGTTGATGAAGCTGATAATATGCTCACATCATTTTAGATGCAATTAGAAAGAACAATC
GTATTTTTAAAGGGTAGAGATATTGTCATTTAGTTTGTTTCTGCTACCTTGACAGAAAAA
AATATTAAATTTATTTATGATGCTTTAAAATTTGATAGCACTTAAGACGAAGATTCTAAA
ATTTTGTATTCAATTGAGTTACCTTGGAAATTAAAAGGTGTTACTTAATATGGATAAGTG
TTAAAAGGAAATAAATAGGAGAATGATATAGAAAAGTATATGATTTGCACTCAATTAGTC
AATTAAGTAATTGAATATAACTCCAAGAACCCTGATTTGGAATCTTAAATTATAATCTTC
TTTAGAAAGATAGCAAGCATTTTAGAATTTGAAAGTAAGATTGCTAGAGAAAAGTTAAAT
TGGAAATATACAACTTGTGCTAATAAAAGTAAAAGAAATGAAAATATATAAAATTTCCGT
GCTGGAAACTATGACATTATGTTAGCCACTAGTGTTATGAGTAGAGGTATTGATATTCGT
AAAGTAGGTTTAGTTATTAACTTTGACATGCCCTTAGAAATGAATGAAAAACTGGAATAC
CTAGATAAACATCAATATTTGCACAATATTGGTAGAACTGGTAGATTTGCAGATTTAGGT
CTATCATTAACTTTCTTCGAAAATGATAAGGTATACGAAAATGCCAAGTATACGATTAAG
GATAGTTTTGAATGCGATTTACTTGACTTCAAAATGGAAAATATGATTCCTGAGTTGGCT
AGTGTTATGAAAAATAACACACAACATCAAAGAGTGCAGTGA


>TTHERM_00392950(protein)
MSDQVEEKKDNQSVNTVMTEDIKKEHLRSIETDKTWDDIFALSPEVRERIKQIYERPTKI
QYLSIGETIEYIQPVITIKCRNGGGKTLTFAIPALEFAYRNKNKKTSKSQQSVQEVHGQS
SQTGATVYCPTSIIIVSTQPLALQIQSVLNNLLVEGVSTEVLFQDQKITQSGQILISTPE
LLYRYLVIEKLIQLDNLCHIAVDEADNMLTSFQMQLERTIVFLKGRDIVIQFVSATLTEK
NIKFIYDALKFDSTQDEDSKILYSIELPWKLKGVTQYGQVLKGNKQENDIEKYMICTQLV
NQVIEYNSKNPDLESQIIIFFRKIASILEFESKIAREKLNWKYTTCANKSKRNENIQNFR
AGNYDIMLATSVMSRGIDIRKVGLVINFDMPLEMNEKLEYLDKHQYLHNIGRTGRFADLG
LSLTFFENDKVYENAKYTIKDSFECDLLDFKMENMIPELASVMKNNTQHQRVQ


>TTHERM_00392950(gene)
ATGAGCGATTAAGTAGAAGAAAAAAAAGATAACTAATCAGTAAATACAGTCATGACTGAA
GATATTAAGAAAGAGCATTTAAGAAGCATTGAGACAGATAAAACTTGGGATGATATTTTT
GCTTTGTCTCCTGAAGTGAGAGAAAGAATTAAACAAATTTACGAAAGGCCTACGAAGATT
TAATATTTGTCTATTGGAGAAACAATTGAATATATATAGCCAGTTATTACAATCAAGTGC
AGAAATGGTGGAGGTAAAACTCTTACTTTTGCTATTCCTGCTTTGGAATTTGCTTACAGA
AATAAAAATAAAAAGACTTCAAAATCCTAGCAATCAGTCTAAGAAGTTCATGGATAGAGT
TCCTAAACTGGAGCAACTGTTTACTGTCCTACATCGATTATTATTGTGTCAACATAGCCA
CTCGCTTTGCAAATTTAAAGCGTTTTAAATAATCTTTTGGTTGAAGTAAATACTCATCGA
AGTTGATAGTTTCTTTAATATTAATTTTATTAAAATTTTTAATAGGGAGTTTCTACAGAA
GTTCTATTCTAAGACCAAAAGATTACTCAATCTGGTTAGATATTGATTTCCACTCCAGAG
CTACTTTACAGATACTTGGTGATAGAAAAGTTAATATAGTTAGATAATTTATGTCATATT
GCTGTTGATGAAGCTGATAATATGCTCACATCATTTTAGATGCAATTAGAAAGAACAATC
GTATTTTTAAAGGGTAGAGATATTGTCATTTAGTTTGTTTCTGCTACCTTGACAGAAAAA
AATATTAAATTTATTTATGATGCTTTAAAATTTGATAGCACTTAAGACGAAGATTCTAAA
ATTTTGTATTCAATTGAGTTACCTTGGAAATTAAAAGGTGTTACTTAATATGGATAAGTG
TTAAAAGGAAATAAATAGGAGAATGATATAGAAAAGTATATGATTTGCACTCAATTAGTC
AATTAAGTAATTGAATATAACTCCAAGAACCCTGATTTGGAATCTTAAATTATAATCTTC
TTTAGAAAGATAGCAAGCATTTTAGAATTTGAAAGTAAGATTGCTAGAGAAAAGTTAAAT
TGGAAATATACAACTTGTGCTAATAAAAGTAAAAGAAATGAAAATATATAAAATTTCCGT
GCTGGAAACTATGACATTATGTTAGCCACTAGTGTTATGAGTAGAGGTATTGATATTCGT
AAAGTAGGTTTAGTTATTAACTTTGACATGCCCTTAGAAATGAATGAAAAACTGGAATAC
CTAGATAAACATCAATATTTGCACAATATTGGTAGAACTGGTAGATTTGCAGATTTAGGT
CTATCATTAACTTTCTTCGAAAATGATAAGGTATACGAAAATGCCAAGTATACGATTAAG
GATAGTTTTGAATGCGATTTACTTGACTTCAAAATGGAAAATATGATTCCTGAGTTGGCT
AGTGTTATGAAAAATAACACACAACATCAAAGAGTGCAGTGA