Identifiers and Description

Gene Model Identifier

TTHERM_00485980

Standard Name

DRH43 (DExD/H box RNA helicase 43)

Aliases

PreTt19530 | 59.m00168 | 3680.m00025

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF02180 ) Bcl-2 homology region 4
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00485980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12099.29.997093137033517e-262helicase domain-containing pro
tein (480 aa)
OxytrichaContig22824.0.g634.998338612125368e-60DEAD/DEAH box helicase
DictyBaseDDB_G02703967.998336109808381e-38ddx49 on chromosome: 1 positio
n 4752654 to 4754329
SGDYPL119C2.0006622580855403e-35DBP1 Putative ATP-dependent RN
A helicase of the DEAD-box pro
tein family; mutants show redu
ced stability of the 40S ribos
omal subunit scanning through
5 untranslated regions of mRNA
s
WormBaseWBGene000192456.99697739292434e-35locus:sacy-1 status:Confirme
d UniProt:Q9N5K1 protein_i
d:CCD72466.1
Stentor CoeruleusSteCoe_123791.5628821893349888e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00485980(coding)
ATGAGACCATTTAAGTTATCAAAAAATATTTTTAGCCACCTTAGACTCTCAAAAAATATA
TTGTTTTATAATTTTTCATCTGATTTCTTCAAAAATTTGCATCTTAATCCCTACTTGTTT
GCAAATTTAAAAGAGAACAAAATTTCTGAGCCTACTTCAATCCAAGTTAAAAGTTTGGAA
CATGTGATAAATGGAGAAAATGCAGTTGTTACTGCAGAAACAGGAAGTGGCAAAACTCTC
TGCTATCTACTTCCTGTTATGAACCATATTTTAAGTAAAAAATTGGATTTAGCTCCTGAA
GTTTATAGATAAAATAGTCCTCGCGGCGCTATTATACTTGTTCCTACCAAAGAATTAGGT
GCATAAGTTTATGCAATGATAAGAAGACTTGATAAAAAAAATAAGCTTGATGTCTCAAGA
ACAGGATCAATAGGATACATAGCCCCAATTAGTGATGATAAACAGCCAAAGGATGCAAGA
ACATCATTGAGATTAAATGATCTTGCCTTTGAAAGTGTAGTTAGAGGCATAGATTGGGAT
TAATTAGATATTTTAGTTTCTACTCCTAGTTAATTGGATTAAATGCTAAAGCTAAAAGAC
CAAACAAATCCATATTAAGTAGATCCAAAATTTATAGTTATTGATGAATTTGACTTGCTT
CTAGGTGATACAAATATTGCTAGGAGTACCATATCTATTCTCAATAGATTTTGTAATGTA
CATAATAATCCTCAAAATATAAACAGATAGTTTATTTTGACAGGAGCAAGTTTTCCTTTA
AGGATTAATAATGAGAAAGGTACCTAATTTATTGACAAAGTTTTTAAAAGACCTATTTGT
ATAGAGAGTGAGAATTTCTACAAAATTAGTGAAAAAATGAAACATGTTGTTATCAGAGTA
AATGATTACTTGAATGCAAACCCTAATTTTTCTATTTAAGACATTCTAGTAGATTAAATC
AAGAAGTCTACTTCTTAAAGAATTATTGTTTTTGTATAATCACAAGCCTCTTCCGAATCT
ATAGCTAAGCACTTGCAGGATCATGATATAAAGGCTCTCTCTTTTCATGCTAATTTGAAT
ACTGAGTAAAGAATAGATACTTTAGCTAATTTTGATGAAGGAAAAGTCAGAGTTTTAGTT
TCAACTGATTTAGCAAGTAGAGGTTTAGACTTTTAAAATGTAGATCATGTCATTTAATTT
GATTTTGCTTTAGATGCAGTAAGCTTTTTGCATAGAGTTGGTAGAACTTGTAGAATGGGC
AGAAATGGAGTAGTTACATCTTTTGTTAGAGAAAACGATGAATTTTTATATGAAAAAGTT
TAAAAATTAATATGTAATCATTAAAGAATAGATCCAATAATCAGTAGAAAAAGGTCATTA
AGTAAAAACTATAAAAGAAGTAAAGGATCAGATGATGAAATGTCAAGTGATGATGATAAT
TGA


>TTHERM_00485980(protein)
MRPFKLSKNIFSHLRLSKNILFYNFSSDFFKNLHLNPYLFANLKENKISEPTSIQVKSLE
HVINGENAVVTAETGSGKTLCYLLPVMNHILSKKLDLAPEVYRQNSPRGAIILVPTKELG
AQVYAMIRRLDKKNKLDVSRTGSIGYIAPISDDKQPKDARTSLRLNDLAFESVVRGIDWD
QLDILVSTPSQLDQMLKLKDQTNPYQVDPKFIVIDEFDLLLGDTNIARSTISILNRFCNV
HNNPQNINRQFILTGASFPLRINNEKGTQFIDKVFKRPICIESENFYKISEKMKHVVIRV
NDYLNANPNFSIQDILVDQIKKSTSQRIIVFVQSQASSESIAKHLQDHDIKALSFHANLN
TEQRIDTLANFDEGKVRVLVSTDLASRGLDFQNVDHVIQFDFALDAVSFLHRVGRTCRMG
RNGVVTSFVRENDEFLYEKVQKLICNHQRIDPIISRKRSLSKNYKRSKGSDDEMSSDDDN


>TTHERM_00485980(gene)
AACAGAATTACAATAAAACTAATAAATCAATAACAAATCTTTATTAAGTTTAAGCCTTTT
AGCTGCATATATTGAATTAGATTTTTAATAGATTTTATTAAAGTTAAAGTTTAAAATTTT
AATAATGAGACCATTTAAGTTATCAAAAAATATTTTTAGCCACCTTAGACTCTCAAAAAA
TATATTGTTTTATAATTTTTCATCTGATTTCTTCAAAAATTTGCATCTTAATCCCTACTT
GTTTGCAAATTTAAAAGAGAACAAAATTTCTGAGCCTACTTCAATCCAAGTTAAAGTCTG
GTTGATTTTTTTAGCTGTTTTTTTTAATTAATATAAATGACCTTAATGATTTTCATACTG
CATCTCTAAATATATTTAATTTATTTTTTTATTCAATAGAGTTTGGAACATGTGATAAAT
GGAGAAAATGCAGTTGTTACTGCAGAAACAGGAAGTGGCAAAACTCTCTGCTATCTACTT
CCTGTTATGAACCATATTTTAAGTAAAAAATTGGATTTAGCTCCTGAAGTTTATAGATAA
AATAGTCCTCGCGGCGCTATTATACTTGTTCCTACCAAAGAATTAGGTGCATAAGTTTAT
GCAATGATAAGAAGACTTGATAAAAAAAATAAGCTTGATGTCTCAAGAACAGGATCAATA
GGATACATAGCCCCAATTGTGCATATTTTAGTATTTTTTAATTTAAAATCTTAAAGAATA
AAACATGAATCCCGGAAAAATATTTTAATCACATTTGAGCTTAATACAGCTTATTCCTTA
TTTTTAGATATGTTAACACAAAAATATACTTCTAGATTTCTAGAAGTTTTTTTTGGAATT
TTGTTTTATTTTAAAATATTATTTTAATTTTCAAATTAAATTAATTTCATAAAAATAATA
AACAACAGAGTGATGATAAACAGCCAAAGGATGCAAGAACATCATTGAGATTAAATGATC
TTGCCTTTGAAAGTGTAGTTAGAGGCATAGATTGGGATTAATTAGATATTTTAGTTTCTA
CTCCTAGTTAATTGGATTAAATGCTAAAGCTAAAAGACCAAACAAATCCATATTAAGTAG
ATCCAAAGTAATAAATTTCAAAACTTTACCTTATTCTTATATTTAATTTTTTTTATCAGA
TTTATAGTTATTGATGAATTTGACTTGCTTCTAGGTGATACAAATATTGCTAGGAGTACC
ATATCTATTCTCAATAGATTTTGTAATGTACATAATAATCCTCAAAATATAAACAGATAG
TTTATTTTGACAGGAGCAAGTTTTCCTTTAAGGATTAATAATGAGAAAGGTACCTAATTT
ATTGACAAAGTTTTTAAAAGACCTATTTGTATAGAGAGTGAGAATTTCTACAAAATTAGT
GAAAAAATGAAACATGTTGTTATCAGAGTAAATGATTACTTGAATGCAAACCCTAATTTT
TCTATTTAAGACATTCTAGTAGATTAAATCAAGAAGTCTACTTCTTAAAGAATTATTGTT
TTTGTATAATCACAAGCCTCTTCCGAATCTATAGCTAAGCACTTGCAGGATCATGATATA
AAGGCTCTCTCTTTTCATGCTAGTAATTAATTATAAAAATAATAGAAAAAATATTAAAAA
TAATTAAATAAATTAGATTTGAATACTGAGTAAAGAATAGATACTTTAGCTAATTTTGAT
GAAGGAAAAGTCAGAGTTTTAGTTTCAACTGATTTAGCAAGTAGAGGTTTAGACTTTTAA
AATGTAGATCATGTCATTTAATTTGATTTTGCTTTAGATGCAGTAAGCTTTTTGCATAGA
GTTGGTAGAACTTGTAGAATGGGCAGAAATGGAGTAGTTACATCTTTTGTTAGAGAAAAC
GATGAATTTTTATATGAAAAAGTTTAAAAATTAATATGTAATCATTAAAGAATAGATCCA
ATAATCAGTAGAAAAAGGTCATTAAGTAAAAACTATAAAAGAAGTAAAGGATCAGATGAT
GAAATGTCAAGTGATGATGATAATTGAGATATTAATAACTCATACATTGATAAAAATTAA
TATAATACAATTATATTTAAAAATTATTAAAAATTTTGTTGATAAAAATAATCTACTCTG
TAAGAATACTATGATTAATTTATAATTAAATAAGTGTAGTTTAAGCTTTAATGTATGTCC
ATTATATTATGAACAATTTAATTTACATTTAAATACTTTAATCTTTG