Identifiers and Description

Gene Model Identifier

TTHERM_00725930

Standard Name

DRH42 (DExD/H box RNA helicase 42)

Aliases

PreTt21859 | 117.m00111

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF03107 ) DC1 domain
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF03202 ) Putative mycoplasma lipoprotein, C-terminal region
  • ( PF04297 ) Putative helix-turn-helix protein, YlxM /

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 14.1%

TetraMine Data

TTHERM_00725930

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04583.19.997093137033517e-262helicase domain-containing pro
tein (738 aa)
OxytrichaContig13621.0.g362.9999146385131704e-95Mitochondrial degradasome RNA
helicase subunit C terminal
DictyBaseDDB_G02789373.0011595823640496e-94DDB_G0278937 on chromosome: 3
position 1214678 to 1217558
WormBaseWBGene000074442.0001503375893664e-79ATP-dependent RNA helicase SUV
3 homolog, mitochondrial sta
tus:Partially_confirmed UniP
rot:Q17828 protein_id:CAJ434
33.1
SGDYPL029W2.999564368270328e-76SUV3 ATP-dependent RNA helicas
e, component of the mitochondr
ial degradosome along with the
RNase Dss1p; the degradosome
associates with the ribosome a
nd mediates RNA turnover; also
required during splicing of t
he COX1 AI5_beta intron
Stentor CoeruleusSteCoe_201301.368539471173853e-44

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00725930(coding)
ATGATTAAGTAGAGAAGATTTATTTTTTACTAAGCTGATATTATTGCTAAGTAATTAATT
TAAAGATAATCATGTATGAATATTAGTATGTTGAATTTAATGGCTATCTAATAGTCATCT
AGTTTATTGCATCAAAAGTCTAAAACGAGGCAAAGGAGCTTATTTTTCTAGAATGTTTGC
AGTTTTACAGATATTGCAGGAACATAACCTCACTAAAATAAAAAAAAAAATGTAAAAAGT
AGTTAAAGTGAGAGCGAGGAAGAGGAAGTAAATATCAGAAAAAAAGAGGACAAAAAAAAA
GATTAAACTGATGCATACCATCTCATTTAAAAGATTTAACACTCTGTGCCTAATATAAGA
TCAAGATATTATAGTATGTATGATACATTTTAAAATATCTATATTGAAGATAATGTTTAG
TTCTTTAAGGAAGCAAGATTTAAATTTAAGATAAATGATATTGCTATTTTTTGTTACTTT
AGCTTGAGGGAAATCTAAGATATGTATAAGAAGGAGCATAAAATTCTTTCATTTATGATG
GAGGATAAAATTATATAGCGTTTTCGTAGCCACTTTGATAAGAACAAAAGATTCTAGAAA
ATATTCTCAAATTACTTTGAGTTACCAATAAATGAAAGATACGAGTTAGTTGCTTAAAAA
TTTGGTCATAGCAACACACAATTTTATTTGGATTTTTATCCTCTATACGATTTGTTTTTC
GCTTTTGCAGCCTAAAATTTAGGAAAAAAATATGAAGAGTCTATTGAAATTTATAATTTA
TTACAAATTGAGGAGCCTCATCATTTATATCAGGATACTCGTAAAATGAAAAGAAAAATT
ATTTATCATTATGGTCCAACAAATTCTGGAAAAACACACTCAGCTTTAGAAACTTTGATG
AGTGCTAAATCTGGAATATACTGTGGTCCACTCAGACTTTTGGCTAGAGAAATTTATTAA
AAATTTAAGTAAAGAGGGTTAAACTGTAATTTAATTACAGGTTAAGAAAAATTAATAGAG
CCTGATTCATAGTTCTACTCTTGTACCACTGAAATAGGATGCTAAAAAATTGATTTGGAT
TTTGATTGTGCTGTTATTGATGAAATATAGTATTTAGGTGATTAAGAGAGAGGTGCTGCA
TGGACTAAAGCTTTTTTAGGTCTTAAGGCTAAGGAAATACATGTCTGTGGCGATGGAAGA
GCACTATAATTAGTAGAGAACATGTGTAAACAAGTTGGTGATTAATTTGAAACAGTCAAA
TATGAAAGAATGAGTTAATTAACTGTTGAAGATAAGCCATTTGAACTTCAAGATTTGCAA
GAAGGAGACTGCTTGATTTGCTTTAGCGTTAATGAGGCTATTTCTTTCAAAAGAATTGTT
AACAATTATATTAACTCTAAAAATCCTGATAATCCTTAGAGTTAAGAAAATTAATGTAGT
ATTATTTATGGTAGATAGCCAGCTGAAATTAAAAAAGAATAAGCTGAACTATTTAATAAT
AGGACACATAAGTATCTTGTTGCTACAAATGCAATAGGTCTTGGACTTAATTTAAATATA
AGAAGAGTAGTTTTCACAACATTTACTAAGAATCATTAAAGTTAAAGAAAAGGTATAGAT
TCGAATGAAATACTTTAGATTGCTGGAAGAGCTGGGAGATATAGGGAAGATGGATTAGTA
ACAGCAAGAAATGTAAAATAGATAAAAATACTAAAAGAAACTCTACAAAAAAGGGATTAA
CTCATATAATAGTAAACCATTTAAAAAGCTGCTTTCTTCCCAACATATGAGCAGATTGAA
GGTTTTAGAGATTGGCTAAGCTAAGGAAAGAAAAAAAAATAGATAAAACTAAGTGAAGTC
TTTCAAAAGTTTGTAAATTATTCTACATTACAAGGAGCCTATTTTATAGAAAATGAAAGA
GAATTTTGTCATAAGGCAGACCTAATTGAAGATTATGGATTGTCTCTTAGTGATTAATTT
ACATTTAGTTAAGCTCCTATGAGATTTGGAAAAGTTTTTGAAAAAGAGAGGGAACTATTC
TAGCTATTTGCTTAAAAATATGCTATGGGATAGGAAATTGCTTTACCAAATCTTTTAAAA
GATGATGATAAAATCAAGAATATTAAATAGCAATAATAAGCCAATAAAGATTCGCTAACA
ATTTATGAATCTCTGTATTACATTTTAGAATTATATATATGGCTTGGGAATAAATTTGGT
GAAGATAGATTCCCTGATATGCAATTAGCTCACAACAAAAAGTCAGTGATTTGTAGTATG
ATGAATGAAATACATTCACATAACTAATATCAATGA


>TTHERM_00725930(protein)
MIKQRRFIFYQADIIAKQLIQRQSCMNISMLNLMAIQQSSSLLHQKSKTRQRSLFFQNVC
SFTDIAGTQPHQNKKKNVKSSQSESEEEEVNIRKKEDKKKDQTDAYHLIQKIQHSVPNIR
SRYYSMYDTFQNIYIEDNVQFFKEARFKFKINDIAIFCYFSLREIQDMYKKEHKILSFMM
EDKIIQRFRSHFDKNKRFQKIFSNYFELPINERYELVAQKFGHSNTQFYLDFYPLYDLFF
AFAAQNLGKKYEESIEIYNLLQIEEPHHLYQDTRKMKRKIIYHYGPTNSGKTHSALETLM
SAKSGIYCGPLRLLAREIYQKFKQRGLNCNLITGQEKLIEPDSQFYSCTTEIGCQKIDLD
FDCAVIDEIQYLGDQERGAAWTKAFLGLKAKEIHVCGDGRALQLVENMCKQVGDQFETVK
YERMSQLTVEDKPFELQDLQEGDCLICFSVNEAISFKRIVNNYINSKNPDNPQSQENQCS
IIYGRQPAEIKKEQAELFNNRTHKYLVATNAIGLGLNLNIRRVVFTTFTKNHQSQRKGID
SNEILQIAGRAGRYREDGLVTARNVKQIKILKETLQKRDQLIQQQTIQKAAFFPTYEQIE
GFRDWLSQGKKKKQIKLSEVFQKFVNYSTLQGAYFIENEREFCHKADLIEDYGLSLSDQF
TFSQAPMRFGKVFEKERELFQLFAQKYAMGQEIALPNLLKDDDKIKNIKQQQQANKDSLT
IYESLYYILELYIWLGNKFGEDRFPDMQLAHNKKSVICSMMNEIHSHNQYQ


>TTHERM_00725930(gene)
ATGATTAAGTAGAGAAGATTTATTTTTTACTAAGCTGATATTATTGCTAAGTAATTAATT
TAAAGATAATCATGTATGAATATTAGTATGTTGAATTTAATGGCTATCTAATAGTCATCT
AGTTTATTGCATCAAAAGTCTAAAACGAGGCAAAGGAGCTTATTTTTCTAGAATGTTTGC
AGTTTTACAGATATTGCAGGAACATAACCTCACTAAAATAAAAAAAAAAATGTAAAAAGT
AGTTAAAGTGAGAGCGAGGAAGAGGAAGTAAATATCAGAAAAAAAGAGGACAAAAAAAAA
GATTAAACTGATGCATACCATCTCATTTAAAAGATTTAACACTCTGTGCCTAATATAAGA
TCAAGATATTATAGTATGTATGATACATTTTAAAATATCTATATTGAAGATAATGTTTAG
TTCTTTAAGGAAGCAAGATTTAAATTTAAGATAAATGATATTGCTATTTTTTGTTACTTT
AGCTTGAGGGAAATCTAAGATATGTATAAGAAGGAGCATAAAATTCTTTCATTTATGATG
GAGGATAAAATTATATAGCGTTTTCGTAGCCACTTTGATAAGAACAAAAGATTCTAGAAA
ATATTCTCAAATTACTTTGAGTTACCAATAAATGAAAGATACGAGTTAGTTGCTTAAAAA
TTTGGTCATAGCAACACACAATTTTATTTGGATTTTTATCCTCTATACGATTTGTTTTTC
GCTTTTGCAGCCTAAAATTTAGGAAAAAAATATGAAGAGTCTATTGAAATTTATAATTTA
TTACAAATTGAGGAGCCTCATCATTTATATCAGGATACTCGTAAAATGAAAAGAAAAATT
ATTTATCATTATGGTCCAACAAATTCTGGAAAAACACACTCAGCTTTAGAAACTTTGATG
AGTGCTAAATCTGGAATATACTGTGGTCCACTCAGACTTTTGGCTAGAGAAATTTATTAA
AAATTTAAGTAAAGAGGGTTAAACTGTAATTTAATTACAGGTTAAGAAAAATTAATAGAG
CCTGATTCATAGTTCTACTCTTGTACCACTGAAATAGGATGCTAAAAAATTGATTTGGAT
TTTGATTGTGCTGTTATTGATGAAATATAGTATTTAGGTAATTATTTACAAATTTTACAA
TTAAATTTAATAATTATTTATTATAAAGGTGATTAAGAGAGAGGTGCTGCATGGACTAAA
GCTTTTTTAGGTCTTAAGGCTAAGGAAATACATGTCTGTGGCGATGGAAGAGCACTATAA
TTAGTAGAGAACATGTGTAAACAAGTTGGTGATTAATTTGAAACAGTCAAATATGAAAGA
ATGAGTTAATTAACTGTTGAAGATAAGCCATTTGAACTTCAAGATTTGCAAGAAGGAGTA
TATATTTATTTATAAAATTTATAATTTATGCCAATCTAAATTAATAAAATGAAGGACTGC
TTGATTTGCTTTAGCGTTAATGAGGCTATTTCTTTCAAAAGAATTGTTAACAATTATATT
AACTCTAAAAATCCTGATAATCCTTAGAGTTAAGAAAATTAATGTAGTATTATTTATGGT
AGATAGCCAGCTGAAATTAAAAAAGAATAAGCTGAACTATTTAATAATAGGACACATAAG
TATCTTGTTGCTACAAATGCAATAGGTCTTGGACTTAATTTAAATATAAGAAGAGTAGTT
TTCACAACATTTACTAAGAATCATTAAAGTTAAAGAAAAGGTATAGATTCGAATGAAATA
CTTTAGATTGCTGGAAGAGCTGGGAGATATAGGGAAGATGGATTAGTAACAGCAAGAAAT
GTAAAATAGATAAAAATACTAAAAGAAACTCTACAAAAAAGGGATTAACTCATATGTAAT
TTAAGCATTAATTTCCTTTTTTTCCAGAATATTTCAAAAAATTTGTTTAATTCTAATAAA
TTAAATGAATAAGTTGAGTAATAAATATATTTAAACCAATAAATATTTATTTCATTTATT
ATTCTAGAAATTTAAAAAAACTAAATTTTTAGTAAAAATTGTTTCAATTCTTGAAATTTG
TTTGATGTTTTGAAATTTAATATTTGATTTCTTTTTTTGTGATGATTAATAAAATTAAAT
TTAGAATAGTAAACCATTTAAAAAGCTGCTTTCTTCCCAACATATGAGCAGATTGAAGGT
TTTAGAGATTGGCTAAGCTAAGGAAAGAAAAAAAAATAGATAAAACTAAGTGAAGTCTTT
CAAAAGTTTGTAAATTATTCTACATTACAAGGAGCCTATTTTATAGAAAATGAAAGAGAA
TTTTGTCATAAGGCAGACCTAATTGAAGATTATGGATTGTCTCTTAGTGATTAATTTACA
TTTAGTTAAGCTCCTATGAGATTTGGAAAAGTTTTTGAAAAAGAGAGGGAACTATTCTAG
CTATTTGCTTAAAAATATGCTATGGGATAGGAAATTGCTTTACCAAATCTTTTAAAAGAT
GATGATAAAATCAAGAATATTAAATAGCAATAATAAGCCAATAAAGATTCGCTAACAATT
TATGAATCTCTGTATTACATTTTAGAATTATATATATGGCTTGGGAATAAATTTGGTGAA
GATAGATTCCCTGATATGCAATTAGCTCACAACAAAAAGTCAGTGATTTGTAGTATGATG
AATGAAATACATTCACATAACTAATATCAATGA