Identifiers and Description

Gene Model Identifier

TTHERM_00219180

Standard Name

DRH41 (DExD/H box RNA helicase 41)

Aliases

PreTt22346 | 18.m00372 | 3701.m00131

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF03879 ) Cgr1 family
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF01779 ) ribosomal L29e protein family
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00219180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06699.19.997093137033517e-262DEAD/DEAH box helicase (875 aa
)
DictyBaseDDB_G02840174.999288603441066e-168ddx10 on chromosome: 4 positio
n 1436851 to 1439670
SGDYJL033W2.0005528695435914e-146HCA4 Putative nucleolar DEAD b
ox RNA helicase; high-copy num
ber suppression of a U14 snoRN
A processing mutant suggests a
n involvement in 18S rRNA synt
hesis
WormBaseWBGene000212772.0003615238957836e-139status:Confirmed UniProt:Q9N
478 protein_id:CCD68135.1
OxytrichaContig17328.0.g282.0009157491910723e-107DEAD/DEAH box helicase
Stentor CoeruleusSteCoe_82121.8251045143570802e-78

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00219180(coding)
ATGAAGGACTTTAATCAAAAGCACAAAAAATTTAATAAGAAAAATGGCAATTAATCCTAA
TAATAAATGAAGAAGAAAGGATTAAAAAAGCATTAAAAGCACCGCTATCATGATGTTGAA
AAATTACAAGATAGAATCAGAAAAGAAACACCTGCATCTGGTGAATACTTGTACGATTAT
AAATTAGAAAAAGCTGAAGAAGATAGAGCTAAGCTGTAGCCTGAAGAATTTAGAAAAAAA
TACAAGATTAATTTCAGTGATCTCCCTATCTCTTACAATACAATTTTTGGTTTGGAAAAA
AGAAAGTTTATTAAAATGACAGAAATATAGAGATGTACAATTCCTCATATTTTAGCAGGA
AGAGATGTATTAGCTGCTTCAAAGACAGGTAGTGGTAAAACACTATCTTATCTTGTTCCT
TTGGTAGAAAGATTATATGTTTAAAAATGGAATCCTTTGGATGGTTTAGGAGCTATAATT
ATATTACCAACTAGAGAATTAGCAACATAGGTTTTTGAAGTATTTAATTCCTTTACTTAG
AATCATGACTTATCAGTAGGTTTAATTATTGGTGGTAAAAATGTCAAATATGAAAAAGAG
CATATGAAAGGTATGAACGTCTTAATTTGTACTCCTGGACGTCTCCTTTAGCATATGGAT
GAAACTCCTGATTTTGATTGCACAAATCTATAAATGTTAGTGATAGATGAAGCTGATCTC
ATCTTAGATTTAGGTTTCAAAGAGCATTTAAATGCAATATTATTAAACTTACCCAAGTCT
CGTTAGACCATATTGTTCTCTGCAACTTTAAGCAAGTCTATCCACGAATTAAGCAAATTG
TCTCTTAAAAATGCTGAACACATATTTTTACATGAAGTTAGATCAACTTAAGACTAAGAT
TCATAGAATGTCATTAACACTAGCATTAAAGATATTTATGAAGCACCCATAAAATTAACC
CAATACTATATGGAAATCAATATTGAAGATAAATTAAACATGCTCTTTTCTTTTTTGAGA
TCTCATAAAAAAAATAAAGTTCTTGTTTTCTTAAGTACTTGCAAATAAGTTCGTTTTGTT
TACGAAGCATTTAGAAGACTCAAGTTAGGACCTCCTGTTTTCGAATTGCATGGTCGTCAA
AAACAAGCTAAAAGATTAGCTATTTTCTTCACTTTTGCAGAGAAGAAGTTTGGTGTACTC
TTCACAACTAATTTGGCAGCTAGAGGTTTAGATTTTCCTGGTGTTGAATGGATTGTTCAA
GTAGATTGTCCAGATGATGTTGTTACTTATGTTCATAGAGTTGGAAGAACTGCTCGTTTC
AAAAATGATGGTAACTCTCTTTTAATGGTTCTTCCTTCTGAAATTAAAATGATCGATAAA
CTGAAAGAAAAAAAAATGAATATTCAAAAGCTTAAAGCAAACCCTGAACATTAGCTTAGT
ATAACTAATTCTTTGCAATCTTATCTAGTAGAAAGTGTTGATTTGAAGTATTTAGCATAA
AGAGCATTTATTTCTTATGTTCGTAGTATCCATTTTGCTGCCGATAAAGAAGTATTTAAT
GTCAACTCTCTTGATTTAAATGGGTTATCAGAAAGCTTAGGTCTTATTCAAACTCCTGTA
ATAAATATTAAGGGTTTAAAGAATGAAGAAAGTGATGATGATAGTGATGGTGAAGAAAGC
AATAGTTCTGATGGTGAAAAGGAAGATGAAGTAATTGTAAAAAAATAAGATAGGTTAGCA
AAGTTAAAAGAAAAGATAAAAAAAATGAAAGAAGAGAAAGCTCGCAAAAAATTAGGATTA
CCTCCCGTTGAAAATAATGAATAAGATGATGATGATAATAATAAAGAAGAGTAAGAAATC
AAGTAGAAAAAAGAAAAGAAATAAAAGTAAAATAAATAAAATGAAGAAATGGAGATTGAA
GAAAATACAACAAAAGCAAGTGATAAAAAAGACAAGAAGAAGAAGAAGGCAAGTATTGAA
ATTAGTGAGGAAAAATAAGCTTAAGTAGATGATTCAAATTAAGCTGATGAAAATAACAAT
GGTAAAAAAGCATTTAGTGTTAAGCATGAAAAGTTAGTGAAAAGAAAAAATTAAGATGTT
CTTAGTGAAAATTATTAGAAACTAAGAAATGAAAAATAAAATAATGATGAAGACGATTTC
TTAGTACCTAAAAAAAAAGGCTAACATGAAGATTTAGATGAGAGTAACTACAAAATTAAT
ACATTAAAAGTTAGTAAAAATAAACTTAAGAAAATACATGAAGATGGTTACTTTGGTGGT
AAGAATATTACCTACTTCACTGATGACGGAAAGTAACTTACTAAGGATGACTTAAAAATG
ATGGAATATAAACAAAATGAAAAGAAGGCCTTGGAGGAAGAAGAAGACTTAGTTAGAAAA
CATGCCTTAAAGTTAGAATTAAATAGATAAATTGACAAGGACAGAGAAAATGCAAGAAGA
AAAGAAAAGAAAGAAAAGAGAAAAATGTTAAAATATGAACAAAATGAATAGTTAATTTAA
AGAAATTAAGCCATTCTTGCAGGAGATAGCTAAGATGAAGAAGAATATGATGATGATTTT
GAAGGCGAATAAATAGAGGAAGAAGAAATTCAAAGTGATTATTCATAGCAAAAGTAAGAC
AATATAGATTCTGAATCAGAATCAGAAGAACAAGTTATTTAAAAGTAAAAGAAGATTAAA
AAGTAAAAAAAACATAAATGA


>TTHERM_00219180(protein)
MKDFNQKHKKFNKKNGNQSQQQMKKKGLKKHQKHRYHDVEKLQDRIRKETPASGEYLYDY
KLEKAEEDRAKLQPEEFRKKYKINFSDLPISYNTIFGLEKRKFIKMTEIQRCTIPHILAG
RDVLAASKTGSGKTLSYLVPLVERLYVQKWNPLDGLGAIIILPTRELATQVFEVFNSFTQ
NHDLSVGLIIGGKNVKYEKEHMKGMNVLICTPGRLLQHMDETPDFDCTNLQMLVIDEADL
ILDLGFKEHLNAILLNLPKSRQTILFSATLSKSIHELSKLSLKNAEHIFLHEVRSTQDQD
SQNVINTSIKDIYEAPIKLTQYYMEINIEDKLNMLFSFLRSHKKNKVLVFLSTCKQVRFV
YEAFRRLKLGPPVFELHGRQKQAKRLAIFFTFAEKKFGVLFTTNLAARGLDFPGVEWIVQ
VDCPDDVVTYVHRVGRTARFKNDGNSLLMVLPSEIKMIDKLKEKKMNIQKLKANPEHQLS
ITNSLQSYLVESVDLKYLAQRAFISYVRSIHFAADKEVFNVNSLDLNGLSESLGLIQTPV
INIKGLKNEESDDDSDGEESNSSDGEKEDEVIVKKQDRLAKLKEKIKKMKEEKARKKLGL
PPVENNEQDDDDNNKEEQEIKQKKEKKQKQNKQNEEMEIEENTTKASDKKDKKKKKASIE
ISEEKQAQVDDSNQADENNNGKKAFSVKHEKLVKRKNQDVLSENYQKLRNEKQNNDEDDF
LVPKKKGQHEDLDESNYKINTLKVSKNKLKKIHEDGYFGGKNITYFTDDGKQLTKDDLKM
MEYKQNEKKALEEEEDLVRKHALKLELNRQIDKDRENARRKEKKEKRKMLKYEQNEQLIQ
RNQAILAGDSQDEEEYDDDFEGEQIEEEEIQSDYSQQKQDNIDSESESEEQVIQKQKKIK
KQKKHK


>TTHERM_00219180(gene)
ATGAAGGACTTTAATCAAAAGCACAAAAAATTTAATAAGAAAAATGGCAATTAATCCTAA
TAATAAATGAAGAAGAAAGGATTAAAAAAGCATTAAAAGCACCGCTATCATGATGTTGAA
AAATTACAAGATAGAATCAGAAAAGAAACACCTGCATCTGGTGTAATAAATTTGGCTTTT
ATTTTACAATATCCTATTATATTCATATTAAAAAATGCATATTGTTAATGATTTTAATTC
GAATTCATAAAATAGGAATACTTGTACGATTATAAATTAGAAAAAGCTGAAGAAGATAGA
GCTAAGCTGTAGCCTGAAGAATTTAGAAAAAAATACAAGATTAATTTCAGTGATCTCCCT
ATCTCTTACAATACAATTTTTGGTATTTACTATTACATTAAAAAGGCTTTTTTTGCCAGC
TAAGAACCAGAATGTTGTTTACAGTTAAATTTAATATGATTTATTAAATAGGTTTGGAAA
AAAGAAAGTTTATTAAAATGACAGAAATATAGAGATGTACAATTCCTCATATTTTAGCAG
GAAGAGATGTATTAGCTGCTTCAAAGACAGGTAGTGGTAAAACACTATCTTATCTTGTTC
CTTTGGTAGAAAGATTATATGTTTAAAAATGGAATCCTTTGGATGGTTTAGGAGCTATAA
TTATATTACCAACTAGAGAATTAGTATGTGTTTTTTTAAATTGAAGAAATTATTTCAATT
TCAAAATCTTAATAGACTTATTCTAAATAAAATAAAAAATTATATAGGCAACATAGGTTT
TTGAAGTATTTAATTCCTTTACTTAGAATCATGACTTATCAGTAGGTTTAATTATTGGTG
GTAAAAATGTCAAATATGAAAAAGAGCATATGAAAGGTATGAACGTCTTAATTTGTACTC
CTGGACGTCTCCTTTAGCATATGGATGAAACTCCTGATTTTGATTGCACAAATCTATAAA
TGTTAGTGATAGATGAAGCTGATCTCATCTTAGATTTAGGTTTCAAAGAGCATTTAAATG
CAATATTATTAAACTTACCCAAGTCTCGTTAGACCATATTGTTCTCTGCAACTTTAAGCA
AGTCTATCCACGAATTAAGCAAATTGTCTCTTAAAAATGCTGAACACATATTTTTACATG
AAGTTAGATCAACTTAAGACTAAGATTCATAGAATGTCATTAACACTAGCATTAAAGTAA
GTTAGATAAACAAGTTAGCACTCTTTAAATATATATCATAAAAATAAAGGATATTTATGA
AGCACCCATAAAATTAACCCAATACTATATGGAAATCAATATTGAAGATAAATTAAACAT
GCTCTTTTCTTTTTTGAGATCTCATAAAAAAAATAAAGTTCTTGTTTTCTTAAGTACTTG
CAAATAAGTTCGTTTTGTTTACGAAGCATTTAGAAGACTCAAGTTAGGACCTCCTGTTTT
CGAATTGCATGGTCGTCAAAAACAAGTATTTAATTAAAACATTTTTATTTAATAAATACA
ATATTTGAATAATTAAAATAGGCTAAAAGATTAGCTATTTTCTTCACTTTTGCAGAGAAG
AAGTTTGGTGTACTCTTCACAACTAATTTGGCAGCTAGAGGTTTAGATTTTCCTGGTGTT
GAATGGATTGTTCAAGTAGATTGTCCAGATGATGTTGTTACTTATGTTCATAGAGTTGGA
AGAACTGCTCGTTTCAAAAATGATGGTAACTCTCTTTTAATGGTTCTTCCTTCTGAAATT
AAAATGATCGATAAACTGAAAGAAAAAAAAATGAATATTCAAAAGCTTAAAGCAAACCCT
GAACATTAGCTTAGTATAACTAATTCTTTGCAATCTTATCTAGTAGAAAGTGTTGATTTG
AAGTATTTAGCATAAAGAGCATTTATTTCTTATGTTCGTAGTATCCATTTTGCTGCCGAT
AAAGAAGTATTTAATGTCAACTCTCTTGATTTAAATGGGTTATCAGAAAGCTTAGGTCTT
ATTCAAACTCCTGTAATAAATATTAAGGGTTTAAAGAATGAAGAAAGTGATGATGATAGT
GATGGTGAAGAAAGCAATAGTTCTGATGGTGAAAAGGAAGATGAAGTAATTGTAAAAAAA
TAAGATAGGTTAGCAAAGTTAAAAGAAAAGATAAAAAAAATGAAAGAAGAGAAAGCTCGC
AAAAAATTAGGATTACCTCCCGTTGAAAATAATGAATAAGATGATGATGATAATAATAAA
GAAGAGTAAGAAATCAAGTAGAAAAAAGAAAAGAAATAAAAGTAAAATAAATAAAATGAA
GAAATGGAGATTGAAGAAAATACAACAAAAGCAAGTGATAAAAAAGACAAGAAGAAGAAG
AAGGCAAGTATTGAAATTAGTGAGGAAAAATAAGCTTAAGTAGATGATTCAAATTAAGCT
GATGAAAATAACAATGGTAAAAAAGCATTTAGTGTTAAGCATGAAAAGTTAGTGAAAAGA
AAAAATTAAGATGTTCTTAGTGAAAATTATTAGAAACTAAGAAATGAAAAATAAAATAAT
GATGAAGACGATTTCTTAGTACCTAAAAAAAAAGGCTAACATGAAGATTTAGATGAGAGT
AACTACAAAATTAATACATTAAAAGTTAGTAAAAATAAACTTAAGAAAATACATGAAGAT
GGTTACTTTGGTGGTAAGAATATTACCTACTTCACTGATGACGGTAATTTTTATTTGACT
ATATTATTTGGTTTTAATTGTTTTATAATATATATCTAGGAAAGTAACTTACTAAGGATG
ACTTAAAAATGATGGAATATAAACAAAATGAAAAGAAGGCCTTGGAGGAAGAAGAAGACT
TAGTTAGAAAACATGCCTTAAAGTTAGAATTAAATAGATAAATTGACAAGGACAGAGAAA
ATGCAAGAAGAAAAGAAAAGAAAGAAAAGAGAAAAATGTTAAAATATGAACAAAATGAAT
AGTTAATTTAAAGAAATTAAGCCATTCTTGCAGGAGATAGCTAAGATGAAGAAGAATATG
ATGATGATTTTGAAGGCGAATAAATAGAGGAAGAAGAAATTCAAAGTGATTATTCATAGC
AAAAGTAAGACAATATAGATTCTGAATCAGAATCAGAAGAACAAGTTATTTAAAAGTAAA
AGAAGATTAAAAAGTAAAAAAAACATAAATGA