Identifiers and Description

Gene Model Identifier

TTHERM_00316180

Standard Name

DRH40 (DExD/H box RNA helicase 40)

Aliases

PreTt20929 | 31.m00231 | 3687.m00033

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF08148 ) DSHCT (NUC185) domain
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF02349 ) Major surface glycoprotein
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( TIGR01216 ) ATP synthase F1, epsilon subunit
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00316180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_162320
WormBaseWBGene000123429.997093137033517e-262locus:mtr-4 mRNA transport h
omolog 4 status:Confirmed
UniProt:Q23223 protein_id:CA
A94235.1
Tetrahymena borealisEI9_08477.19.997093137033517e-262DEAD/DEAH box helicase (1038 a
a)
DictyBaseDDB_G02756339.997093137033517e-262DDB_G0275633 on chromosome: 2
position 5972320 to 5975825
OxytrichaContig19419.0.g479.997093137033517e-262DSHCT (NUC185) domain
SGDYJL050W9.997093137033517e-262MTR4 ATP-dependent 3-5 RNA hel
icase of the Dead-box family,
involved in nuclear RNA proces
sing and degradation both as a
component of the TRAMP comple
x and in TRAMP independent pro
cesses; has a KOW domain that
shows RNA binding activity

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00316180(coding)
ATGCTTATTGTGTACTAAGAATTAATTAGAAATATGAATAGATTTGTTTAGTAGCAGTAA
ATAGATAGATAAAGAATAAAATTAAATTTGTATAGATTAGCTATTAGAAATATTCCGCTA
AATTATATTATATTAAAAGATATATAAACTACATATCGAATAAAAAACATGGGCGATATA
GATGAGCTCTTTGGAGCCTTCGAAGAAGAAGTAACTGAATAGTCAGTTTAAGTAGATTTG
AATGCCAAAAGAAAGTTAGTTGAATCTTAGGAAAATGGCAATTCAGAAGAATAGTATGAA
GAAATCTCTAAAAAACAAAAGAAAGATACTGATGAAAATATTGATGAAAAGATTTATCCA
GATACATTTGTTGAAGAAGTAGATCCAAATTTAGACGCAGATGAAGCAAATGACGAAAAA
CAAAAAATGTACAATGTTGAACATTTTGAGATAAAAAATGACAAGGGAAAGATTGAAAAT
TGCTGGCACGAAGTGTTTTATCCAGAAGGATATGAGTTTAAGCCCAAACCAAAGAGGCCA
GCTGCCAAAGAGTATCCTTTTAAGTTGGATCATTTCTAGAGAAAGGCAGTAAATTGCATA
GAGTGTAATGAATCAGTTTTAGTAGCAGCCCACACTTCAGCAGGTAAAACCGCTGTTGCT
GAATATGCTATTGCCCAATCTCTTAGAGACAAACAAAAAGTCATTTATACATCTCCCATT
AAGGCATTATCAAATTAAAAGTACAGAGAATTATAAAAGGAATTTAAAGATGTAGGTTTA
GTCACTGGTGATGTTAGTATTAATTAAACTGCTAGTTGCTTAGTTATGACTACTGAAATT
CTTAGATCTATGCTTTATAGAGGTTCTGAAATCACAAGAGAAGTTGCTTGGGTTATTTTC
GATGAAGTGCATTATATGAGAGATAAGGAAAGAGGTGTTGTTTGGGAAGAAACAATGATT
CTTTTAAATTAAAATGTTAGATATGTTTTCCTTTCTGCTACTATTCCAAATGCAGCTGAA
TTTGCAGAGTGGATTTGCCGTATCAAGAAGTAGCCTTGTCATGTAGTTTACACTGATTAC
AGACCTGTTCCTCTCTAGCATTTTATTTTCCCTACTGGAGGTGAAGGTATTTACTTGATA
GTAGATCATAAGGGCACATTTAGAGAAGACAATTTTTAGAAGGCATTAAGTGTAATGGGA
GATAATATAGATTTAACAAATACAGATAAGAAAAAGAGAAAGAAACCCACAGAAGGAGCT
GAATTAAATAAAATATTGAAGTTAATATCTACAAAGAATCTTGAACCTGCTATTGTTTTC
TCTTTCTCTAAGAGAGATGTTGAAAGTTACGCTAAAGCAATGAATAATATGGATCTTACC
ACTTAAGATGAAAAAGAAAAAATTGATAGCGTTTTTTAGAGTGCTATTTCATAGCTTGCA
GAAGAAGATTAAAAGTTACCTTAAATTACTTAGATTCTTCCCATTTTGAAAAGAGGTATT
GGTATGCATCATGGTGGTTTGTTGCCTATCGTAAAAGAAATTATTGAAATTTTGTTCTAG
TAGGGTTGGTTGAAGATTTTATTCTCAACTGAAACATTTTCTATGGGTCTTAATATGCCT
GCTCGTACTGTCGTCTTTACTTCAGTTCGTAAGTTCGATGGTGAAGATTTTAGATGGATA
TAAGGTGGTGAATATATTTAAATGTCAGGTAGAGCTGGTAGAAGAGGCAAAGATGACAAA
GGTTTTACTATTTTGATGGTTGATTAGAAGATGGAACCCGAAGTTGCTAAGGGTATGCTT
AAGGGTTAAGCTGATCCTTTGAATTCTTCTTTCCATTTGTGTTATAATATGCTTATAAAT
TCTATGCGTTTAGAAGATAACGATCCTGAGTATATTATCAGACGTTCCTTACATTAATTC
TAGAATGACAAACAATTACCATAAATGAAAGAAAAGTACAATGAATTAGTTTAAAAGAAA
GAAAGCCTTAGCATTTAAAATGAAAGCTAAATTGCTGAAATTTGCAAATTCAGAGAATAA
ATTAAGATTTATGAAGAAAAGGAAAGAAGAATTGTTATATAAGAAAAGTATGTTTTGCCA
TATCTTCACATAGGAAGACTTATTAGAGTTCAATATAAAAACTAAGATTGGGGTTGGGGA
ATTTCAATCAACTTCCATTAAAAGAAAGTATAGTAAAAAAAGAAGAAGAAATCTAATGAA
GATGAGCCTGAAGATATTATCATTGTAGACATCATGTGTCATATAAAACCCAGACAAAAC
AATGAAGAACCTAAACCTGCCTTAATTACTGAAGAAGGTGAACTTGAGGTTATCCCTATG
AATCTCTCCACAATTACCGAAATTAGTAGCATAAAGCTAGACTTGCCAAGCAGATTAGAC
ACACTTGAAAATAAGCTACTCATTAAAGAAACCTTGAAGGAGATTAGAAAGTAATTCCCT
GAAGTTCCAAAAATTCACCCAATCAAGGATATGAAAATCTTGAATGATGAGTTAATTAGA
GTTTTAGATAAGAAAGAAAAGCTTAAAGAATCTATGGAAAAGGAGATGTAAAAATCAGAA
ATTCCAAATTTGTAATAGTAAATTGAATAATACGAGTAAAAATAAAAACTCCACATCTCT
ATCTTAAGACTCAAAGAAGAAATAGAAAAGAGCTAGAAAATGGTTTTACAAGATGATTTA
GCTTGTATGAAGAGAGTTATGAGAAGATTGGGATTCATAAGTAAAGATTAAATTGTCCAA
TTACCTGGTAAAGTCGCTTGTGAAGTTTCTGCATGTGATGAAATATTAGCCACTTAGTTA
TTACTCTCAAATTTCTTTAATGAAATGAGTCCAAACCATATTGCTGCCCTCCTTTCATGC
CTTGTCCACGATGAAAATAACTCATAAGAAAACCAATAAATTCAAGATTAAGATTTGGCT
TTATATTTTGAGAAGGTAGTAGAAATAGCTAAAGGTATATACACTGTTATGTAAGAATCA
AAGATGTAAATTGAAGAAAAAGATTATCTTGGAACCTTAAAGCCCTAATTGATGGAAGTT
GTTTACAAGTGGTGCTAGGGAAGCTCCTTTGCTGATATCTGTAAATTAACTAATTGCTAT
GAAGGATCAATTATTAGATGTATGAGAAGACTTGATGAATTGTTAAAATAGATGGAAAGT
GCTTGCAAAGTTATGGGTAATGAAATTCTTGGAGAGAAATTTAAAGAAGCCTCTAAGAAT
CTCAAAAGAGGCATTATTTTTGCTGCTTCTTTATATGTTTGA


>TTHERM_00316180(protein)
MLIVYQELIRNMNRFVQQQQIDRQRIKLNLYRLAIRNIPLNYIILKDIQTTYRIKNMGDI
DELFGAFEEEVTEQSVQVDLNAKRKLVESQENGNSEEQYEEISKKQKKDTDENIDEKIYP
DTFVEEVDPNLDADEANDEKQKMYNVEHFEIKNDKGKIENCWHEVFYPEGYEFKPKPKRP
AAKEYPFKLDHFQRKAVNCIECNESVLVAAHTSAGKTAVAEYAIAQSLRDKQKVIYTSPI
KALSNQKYRELQKEFKDVGLVTGDVSINQTASCLVMTTEILRSMLYRGSEITREVAWVIF
DEVHYMRDKERGVVWEETMILLNQNVRYVFLSATIPNAAEFAEWICRIKKQPCHVVYTDY
RPVPLQHFIFPTGGEGIYLIVDHKGTFREDNFQKALSVMGDNIDLTNTDKKKRKKPTEGA
ELNKILKLISTKNLEPAIVFSFSKRDVESYAKAMNNMDLTTQDEKEKIDSVFQSAISQLA
EEDQKLPQITQILPILKRGIGMHHGGLLPIVKEIIEILFQQGWLKILFSTETFSMGLNMP
ARTVVFTSVRKFDGEDFRWIQGGEYIQMSGRAGRRGKDDKGFTILMVDQKMEPEVAKGML
KGQADPLNSSFHLCYNMLINSMRLEDNDPEYIIRRSLHQFQNDKQLPQMKEKYNELVQKK
ESLSIQNESQIAEICKFREQIKIYEEKERRIVIQEKYVLPYLHIGRLIRVQYKNQDWGWG
ISINFHQKKVQQKKKKKSNEDEPEDIIIVDIMCHIKPRQNNEEPKPALITEEGELEVIPM
NLSTITEISSIKLDLPSRLDTLENKLLIKETLKEIRKQFPEVPKIHPIKDMKILNDELIR
VLDKKEKLKESMEKEMQKSEIPNLQQQIEQYEQKQKLHISILRLKEEIEKSQKMVLQDDL
ACMKRVMRRLGFISKDQIVQLPGKVACEVSACDEILATQLLLSNFFNEMSPNHIAALLSC
LVHDENNSQENQQIQDQDLALYFEKVVEIAKGIYTVMQESKMQIEEKDYLGTLKPQLMEV
VYKWCQGSSFADICKLTNCYEGSIIRCMRRLDELLKQMESACKVMGNEILGEKFKEASKN
LKRGIIFAASLYV


>TTHERM_00316180(gene)
CAAAATATCATCGTTATAAATGCTTATTGTGTACTAAGAATTAATTAGAAATATGAATAG
ATTTGTTTAGTAGCAGTAAATAGATAGATAAAGAATAAAATTAAATTTGTATAGATTAGC
TATTAGAAATATTCCGCTAAATTATATTATATTAAAAGATATATAAACTACATATCGAAT
AAAAAACATGGGCGATATAGATGAGCTCTTTGGAGCCTTCGAAGAAGAAGTAACTGAATA
GTCAGTTTAAGTAGATTTGAATGCCAAAAGAAAGTTAGTTGAATCTTAGGAAAATGGCAA
TTCAGAAGAATAGTATGAAGAAATCTCTAAAAAACAAAAGAAAGATACTGAGTAGACATT
TATCAATAGATAGAATATATAAAAAAAACATAAAAATTGAACTATTTTTATAATTTATTA
GTGAAAATATTGATGAAAAGATTTATCCAGATACATTTGTTGAAGAAGTAGATCCAAATT
TAGAGTAATTAACTTAATTTAATCATAAGTTTCATTTTTTTGTATGTACCAACATTCATT
TTATAATCTCAAACATATAAAATAGCGCAGATGAAGCAAATGACGAAAAACAAAAAATGT
ACAATGTTGAACATTTTGAGATAAAAAATGACAAGGGAAAGATTGAAAATTGCTGGCACG
AAGTGTTTTATCCAGAAGGATATGAGTTTAAGCGTAATCATTTAAAAATATAATAAGATT
AAGTAGATATAATTATTCCATTTCAAAAAATTAGCCAAACCAAAGAGGCCAGCTGCCAAA
GAGTATCCTTTTAAGTTGGATCATTTCTAGAGAAAGGCAGTAAATTGCATAGAGTGTAAT
GAATCAGTTTTAGTAGCAGCCCACACTTCAGCAGGTAAAACCGCTGTTGCTGAATATGCT
ATTGCCCAATCTCTTAGAGACAAACAAAAAGTCATTTATACATCTCCCATTAAGGCATTA
TCAAATTAAAAGTACAGAGAATTATAAAAGGAATTTAAAGATGTAGGTTTAGTCACTGGT
GATGTTAGTATTAATTAAACTGCTAGTTGCTTAGTTATGACTACTGAAATTCTTAGATCT
ATGCTTTATAGAGGTTCTGAAATCACAAGAGAAGTTGCTTGGGTTATTTTCGATGAAGTG
CATTATATGAGAGATAAGGAAAGAGGTGTTGTTTGGGAAGAAACAATGATTCTTTTAAAT
TAAAATGTAATTTATTTTTAAAGTTTTCTCATCCAATAATTTAAAAACTTATTTATAGGT
TAGATATGTTTTCCTTTCTGCTACTATTCCAAATGCAGCTGAATTTGCAGAGTGGATTTG
CCGTATCAAGAAGTAGCCTTGTCATGTAGTTTACACTGATTACAGACCTGTTCCTCTCTA
GCATTTTATTTTCCCTACTGGAGGTGAAGGTATTTACTTGATAGTAGATCATAAGGTAAA
ATTAGAAGATTTCAATTAACTTTTGAGCTGAGAGACTAATCAAACATTTTAAAAGGGCAC
ATTTAGAGAAGACAATTTTTAGAAGGCATTAAGTGTAATGGGAGATAATATAGATTTAAC
AAATACAGATAAGAAAAAGAGAAAGAAACCCACAGAAGGAGCTGAATTAAATAAAATATT
GAAGTTAATATCTACAAAGAATCTTGAACCTGCTATTGTTTTCTCTTTCTCTAAGAGAGA
TGTTGAAAGTTACGCTAAAGCAATGAATAATATGGATCTTACCACTTAAGATGAAAAAGA
AAAAATTGATAGCGTTTTTTAGAGTGCTATTTCATAGCTTGCAGAAGAAGATTAAAAGTT
ACCTTAAGTAAATAAATAAAAGATTTGATCTTTTTGTTTATTAAAATATTTTTATAAATA
TTCAGATTACTTAGATTCTTCCCATTTTGAAAAGAGGTATTGGTATGCATCATGGTGGTT
TGTTGCCTATCGTAAAAGAAATTATTGAAATTTTGTTCTAGTAGGGTTGGTTGAAGATTT
TATTCTCAACTGAAACATTTTCTATGGGTCTTAATATGCCTGCTCGTACTGTCGTCTTTA
CTTCAGTTCGTAAGTTCGATGGTGAAGATTTTAGATGGATATAAGGTGGTGAATATATTT
AAATGTCAGGTAGAGCTGGTAGAAGAGGCAAAGATGACAAAGGTTTTACTATTTTGATGG
TTGATTAGAAGATGGAACCCGAAGTTGCTAAGGGTATGCTTAAGGGTTAAGCTGATCCTT
TGAATTCTTCTTTCCATTTGTGTTATAATATGCTTATAAATTCTATGCGTTTAGAAGATA
ACGATCCTGAGTATATTATCAGACGTTCCTTACATTAATTCTAGAATGACAAACAATTAC
CATAAATGAAAGAAAAGGTAAACATTTTTAATACTATTTTCGTAACTAAGTTAACTTAAT
GTTTAATTAATGTAGTACAATGAATTAGTTTAAAAGAAAGAAAGCCTTAGCATTTAAAAT
GAAAGCTAAATTGCTGAAATTTGCAAATTCAGAGAATAAATTAAGATTTATGAAGAAAAG
GAAAGAAGAATTGTTATATAAGAAAAGTATGTTTTGCCATATCTTCACATAGGAAGACTT
ATTAGAGTTCAATATAAAAACTAAGATTGGGGTTGGGGAATTTCAATCAACTTCCATTAA
AAGAAAGTATAGTAAAAAAAGAAGAAGAAATCTAATGAAGATGAGCCTGAAGATATTATC
ATTGTAGACATCATGTGTCATATAAAACCCAGACAAAACAATGAAGAACCTAAACCTGCC
TTAATTACTGAAGAAGGTGAACTTGAGGTTATCCCTATGAATCTCTCCACAATTACCGAA
ATTAGTAGCATAAAGCTAGACTTGCCAAGCAGATTAGACACACTTGAAAATAAGCTACTC
ATTAAAGAAACCTTGAAGGAGGTACTTTTTTTAACAAAATTTCAACAAAAAAAAATATTT
ATTTTAAAAACTAATAAATAAAGATTAGAAAGTAATTCCCTGAAGTTCCAAAAATTCACC
CAATCAAGGATATGAAAATCTTGAATGATGAGTTAATTAGAGTTTTAGATAAGAAAGAAA
AGCTTAAAGAATCTATGGAAAAGGAGATGTAAAAATCAGAAATTCCAAATTTGTAATAGT
AAATTGAATAATACGAGTAAAAATAAAAACTCCACATCTCTATCTTAAGACTCAAAGAAG
AAATAGAAAAGAGCTAGAAAATGGTTTTACAAGTATAATCATTAATTTATTTTATATGTT
TAGTGAATTAAATTTAATATTTTAGGATGATTTAGCTTGTATGAAGAGAGTTATGAGAAG
ATTGGGATTCATAAGTAAAGATTAAATTGTCCAATTACCTGGTAAAGTCGCTTGTGAAGT
TTCTGCATGTGATGAAATATTAGCCACTTAGTTATTACTCTCAAATTTCTTTAATGAAAT
GAGTCCAAACCATATTGCTGCCCTCCTTTCATGCCTTGTCCACGATGAAAATAACTCATA
AGAAAACCAATAAATTCAAGATTAAGATTTGGCTTTATATTTTGAGAAGGTAGTAGAAAT
AGCTAAAGGTATATACACTGTTATGTAAGAATCAAAGATGTAAATTGAAGAAGTAAAAAC
TATTTTTTTAATTAACAATATTTATCTTAATAATTTTTTAACTAATTAAACAGAAAGATT
ATCTTGGAACCTTAAAGCCCTAATTGATGGAAGTTGTTTACAAGTGGTGCTAGGGAAGCT
CCTTTGCTGATATCTGTAAATTAACTAATTGCTATGAAGGATCAATTATTAGATGTATGA
GAAGACTTGATGAATTGTTAAAATAGATGGAAAGTGCTTGCAAAGTTATGGGTAATGAAA
TTCTTGGAGAGAAATTTAAAGAAGCCTCTAAGAATCTCAAAAGAGGCATTATTTTTGCTG
CTTCTTTATATGTTTGATAAATAAAAATATTTTAAAATAATTAACAAAATAATGTTTATA
TTTATTTATATAAGTATTTTCATTAAAAATTATTACTAAGTTATAATCTC