Identifiers and Description

Gene Model Identifier

TTHERM_00295100

Standard Name

DRH4 (DExD/H box RNA helicase 4)

Aliases

PreTt15620 | 27.m00280 | 3692.m00083

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF02487 ) CLN3 protein
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF01733 ) Nucleoside transporter
  • ( TIGR00939 ) Nucleoside Transporter
  • ( TIGR02614 ) cell division protein FtsW
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF07690 ) transporter, major facilitator family
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family
  • ( PF08290 ) Hepatitis core protein, putative zinc
  • ( TIGR00881 ) phosphoglycerate transporter family protein
  • ( PF01059 ) NADH-ubiquinone oxidoreductase chain 4, amino

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00295100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08774.19.997093137033517e-262CLN3 protein (1138 aa)
OxytrichaContig20704.0.g655.997537942519205e-151DEAD/DEAH box helicase
DictyBaseDDB_G02885017.999856284897459e-146ddx42 on chromosome: 5 positio
n 1607944 to 1611404
WormBaseWBGene000081199.999130229490956e-141status:Partially_confirmed U
niProt:Q93382 protein_id:CAB
03765.1
SGDYNL112W1.99959632430224e-111DBP2 Essential ATP-dependent R
NA helicase of the DEAD-box pr
otein family, involved in nons
ense-mediated mRNA decay and r
RNA processing
Stentor CoeruleusSteCoe_126031.1379798735078682e-50

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00295100(coding)
ATGGGAGATTGGAGAAAAAAAAGACAACTTACTGAAGATTTGAGATAAGATAAGTATTTT
GATGAAGAAGATGATGAGCAACAATAAAATAATGAAAACAATAATGATGGAGATGATGAA
GAAGATGAACTTGATGCCTTTATGAAAGGAATAGAAGAATAAGCCGATAAAGATATAAAA
GAAACAATATAAAAAAAGGAAAACCCAGATTTACTAAATTTAAATACCAAAAGAAAAGCT
GGTGAAAGATTAGATGAAGATGATCATTTAGATACTTATATGGATAGCATTAAAAAGAAA
CTTATTTAAGAGGCTGATAAAATGAATCCAAATAAAAAAAGCAAAAAATAAAAAGACAAA
AATGAAAATAGTAGTAATGATAATAGCGAAGATGATTATGAAGAAGAAGATGAGGATAAT
AACAATTAATACGATTTCTTAGATAGTGATGGAGAAGTAGACTTTAATAAGGTTAAAGAA
ATGAAGAAAAAAAACTTTTAGCTCCTAGAATAAGTAGATCACTCTTCAATTAAATATGAA
GCTTTTACTAAAAATTTTTATTAAGAACATCCTGATATTACAAAGCTTACAGAATAGTAA
GTTGAAAAAATAAGAAAAGAATTTGAAATAAAGGTTAGTGGAGTCAGACCACCAAAGCCT
ATTGTAAGTTTTGGTCATTTAGGATTTGACGAAGAGTTAATGAGATAAATCACAAAATTA
GGATTTGAAAAACCTACTTAAATTCAATGTCAAGCTCTACCTTGCGGATTAAGTGGTAGA
GACATAGTTGGTGTTGCTAAAACAGGTTCAGGAAAAACTGTTTCTTATCTTTGGCCTCTT
TTAATTCATATCCTTGATTAAAGAGAATTAGAAAAAAATGAAGGCCCTATTGGGTTAATA
TTAGCACCAACAAGAGAACTTTGCCAATAAGTCTATACTGAGTCGAAAAGATATGCAAAA
ATTTATAACATATCAGTTGGAGCTCTTTTAGGTGGAGAGAATAAACATGAATAATGGAAG
ATGCTTAAAGCTGGTGTCGAAATTCTAATAGCAACACCTGGTAGACTTATGGAGATGATT
CAAAAGAAAGCAACAAATCTAAGAAGGTGCACTTACGTAGTTATTGATGAAGCTGATAAA
ATGTTTAGTATGGGTTTTGAAAAGTAGATTCGTTCAATAATGCAATAGATAAGACCAGAC
CGTTAAACTTTACTGTTTACTGCTACTCTGAAAAAAAAAATATAAAATTTAGTTATGGAT
GTGTTAAGAAATCCTGTTACTATTAAGATAGGTGGAGAAAATTAAGCAAATGAAGATATA
AGATAGGAGCCAATCATATTTAAGGATTCAAATTTTAAAGATTAATGGATTTTAAATAAT
TTAAACTTGTGTTTGTAAAAAGGAAAAGTTTTAATTTTTGTTAATCACATTACTAATTGT
AATAAATTATCAGAACTGATTAAATAGAGGTTGTACTTAGAAGCACTTGTATTACACGGT
GATAAAATACAAAGTGAAAGAACTGATATAATTAATAAATTTAAAGCAGCTAAAAACCTA
TTAATAGCAACTGATGTTGCTTCTCGTGGTTTGGATATACCTGAAATAAAAACAGTAATT
AATTATGATTTACCTCAAGATACTGATACTTATATCCACCGTATTGGTAGAACAGGAAGA
GCAGGAGCAACAGATGGCACTGCATATAGTCTGATATTAATGAGTGAAAGTAAATTCGCA
TCAGATATGCTAAAAGTTATGGAAATAAGCGGTTAGCCTGTCCCACCTAATTTAGAAGAA
GTAGCCATGAATGATGATTAATTTAAAGCATAGCGCTTGGCTACAAAGCTAGGTGTTGAC
TTTGCCAAGGGAAAAGATTCTTCTAAGCTATTAAAATAAGCTCTTTCTAGATAAAGAAAC
ACAAAACATGGACTTGGCTACAAGCAAGAAGATGAACTAAGTATAAAAGACTAAATTAAG
GCTGATGTTGATTAGGATATTAAAAAACAAAAAATATCACAAACTCAAGCACCACCTCCT
CCATTATTTGATTTAGAATAGTTGATTAGCTAAAAAGATCTACTTGAATAAGAAGAGCAA
AAATTATTAAAAGAAAAAGAAAAGGCAATATAGACTTAAAAAATAGTTAGAGAGTATTAA
GAGTAGCTGCTACAAACAGGAAAAATAACTTAAGAATAGTTTAACATACAAGCACAATTG
TAATAATTATAAATTAATGAGAAAGAAATAATATTTTAGCAAATATAAGACTAATTACAG
TTTGTTCGTATTTAAATATAGCAGGCTTAAAATTAAAAATCTTCAATTACTTCAAACAGT
TCTAGTAGTTAACAATAGTAATAGCAGTAAAATTAGCCAGTATAAAATTAAGTGCCTTAG
AGATAGTCTAGAGAGAGTATAATGGAAAATTTTAGAGATCAGATGAAAAAAGGCATGTAA
TAATAATTCAGAAGTGGATTTGTGAGTGGAGGAATGCTTCAGAAAAAAAAGTGA


>TTHERM_00295100(protein)
MGDWRKKRQLTEDLRQDKYFDEEDDEQQQNNENNNDGDDEEDELDAFMKGIEEQADKDIK
ETIQKKENPDLLNLNTKRKAGERLDEDDHLDTYMDSIKKKLIQEADKMNPNKKSKKQKDK
NENSSNDNSEDDYEEEDEDNNNQYDFLDSDGEVDFNKVKEMKKKNFQLLEQVDHSSIKYE
AFTKNFYQEHPDITKLTEQQVEKIRKEFEIKVSGVRPPKPIVSFGHLGFDEELMRQITKL
GFEKPTQIQCQALPCGLSGRDIVGVAKTGSGKTVSYLWPLLIHILDQRELEKNEGPIGLI
LAPTRELCQQVYTESKRYAKIYNISVGALLGGENKHEQWKMLKAGVEILIATPGRLMEMI
QKKATNLRRCTYVVIDEADKMFSMGFEKQIRSIMQQIRPDRQTLLFTATLKKKIQNLVMD
VLRNPVTIKIGGENQANEDIRQEPIIFKDSNFKDQWILNNLNLCLQKGKVLIFVNHITNC
NKLSELIKQRLYLEALVLHGDKIQSERTDIINKFKAAKNLLIATDVASRGLDIPEIKTVI
NYDLPQDTDTYIHRIGRTGRAGATDGTAYSLILMSESKFASDMLKVMEISGQPVPPNLEE
VAMNDDQFKAQRLATKLGVDFAKGKDSSKLLKQALSRQRNTKHGLGYKQEDELSIKDQIK
ADVDQDIKKQKISQTQAPPPPLFDLEQLISQKDLLEQEEQKLLKEKEKAIQTQKIVREYQ
EQLLQTGKITQEQFNIQAQLQQLQINEKEIIFQQIQDQLQFVRIQIQQAQNQKSSITSNS
SSSQQQQQQQNQPVQNQVPQRQSRESIMENFRDQMKKGMQQQFRSGFVSGGMLQKKK


>TTHERM_00295100(gene)
ATGGGAGATTGGAGAAAAAAAAGAGTAAAAATTTTAAAGGAAAAATGATAGATTTTTTTA
ATGATAAATTAATAAAGCAACTTACTGAAGATTTGAGATAAGATAAGTATTTTGATGAAG
AAGATGATGAGCAACAATAAAATAATGAAAACAATAATGATGGAGATGATGAAGAAGATG
AACTTGATGCCTTTATGAAAGGAATAGAAGAATAAGCCGATAAAGATATAAAAGAAACAA
TATAAAAAAAGGAAAACCCAGATTTACTAAATTTAAATACCAAAAGAGTATTTCAATAAA
CTTTGACAAAGATTTTAAATTTTTAATTTTTAGAAAGCTGGTGAAAGATTAGATGAAGAT
GATCATTTAGATACTTATATGGATAGCATTAAAAAGAAACTTATTTAAGAGGCTGATAGT
ATAATTTTTATTAAAAATGTTTAGTTTTTCAAATTCTTTTATAAAACAAAAGAAATGAAT
CCAAATAAAAAAAGCAAAAAATAAAAAGACAAAAATGAAAATAGTAGTAATGATAATAGC
GAAGATGATTATGAAGAAGAAGATGAGGATAATAACAATTAATACGATTTCTTAGATAGT
GATGGGTACACTTCTTGATTATTTTAAATTTAAATAAATTTAATCTTTTAATATTCTACA
AAATAAAAAGAGAAGTAGACTTTAATAAGGTTAAAGAAATGAAGAAAAAAAACTTTTAGC
TCCTAGAATAAGTAGATCACTCTTCAATTAAATATGAAGCTTTTACTAAAAATTTTTATT
AAGAACATCCTGATATTACAAAGCTTACAGAATAGTAAGTTGAAAAAATAAGGTAGTTTG
TTTAAATTTTAATCTTATACCATGTTAAATAATTATTATAATAAAGAAAAGAATTTGAAA
TAAAGGTTAGTGGAGTCAGACCACCAAAGCCTATTGTAAGTTTTGGTCATTTAGGATTTG
ACGAAGAGTTAATGAGATAAATCACAAAATTAGGATTTGAAAAACCTACTTAAATTCAAT
GTCAAGTATGCTAGTTTCTATTCAATTATTTCATATTCAATTTATTTATTATAAAGGCTC
TACCTTGCGGATTAAGTGGTAGAGACATAGTTGGTGTTGCTAAAACAGGTTCAGGAAAAA
CTGTTTCTTATCTTTGGCCTCTTTTAATTCATATCCTTGATTAAGTAAAGCAATTTGCAA
ATCAATGCAGTTAGTTATCTTATTATTTTTAATTTAGAGAGAATTAGAAAAAAATGAAGG
CCCTATTGGGTTAATATTAGCACCAACAAGAGAACTTTGCCAATAAGTCTATACTGAGTC
GAAAAGATATGCAAAAATTTATAACATATCGTAAAAAATCTATTTATAATTAATTTTTTA
TGAAAATCGTTTTATTAAACTTTTTAGAGTTGGAGCTCTTTTAGGTGGAGAGAATAAACA
TGAATAATGGAAGATGCTTAAAGCTGGTGTCGAAATTCTAATAGCAACACCTGGTAGACT
TATGGAGATGATTCAAAAGAAAGCAACAAATCTAAGAAGGTGCACTTACGTAGTTATTGA
TGAAGCTGATAAAATGTTTAGTATGGGTTTTGAAAAGTAGATTCGTTCAATAATGCAATA
GATAAGACCAGACCGTTAAACTTTACTGTTTACTGCTACTCTGAAAAAAAAAATATAAAA
TTTAGTTATGGATGTGTTAAGAAATCCTGTTACTATTAAGATAGGTGGAGAAAATTAAGC
AAATGAAGATATAAGATAGGAGCCAATCATATTTAAGGATTCAAATTTTAAAGATTAATG
GATTTTAAATAATTTAAACTTGTGTTTGTAAAAAGGAAAAGTTTTAATTTTTGTTAATCA
CATTACTAATTGTAATAAATTATCAGAACTGATTAAATAGAGGTTGTACTTAGAAGCACT
TGTATTACACGGTGATAAAATACAAAGTGAAAGAACTGATATAATTAATAAATTTAAAGC
AGCTAAAAACCTATTAATAGCAACTGATGTTGCTTCTCGTGGTTTGGATATACCTGAAAT
AAAAACAGTAATTAATTATGATTTACCTCAAGATACTGATACTTATATCCACCGTATTGG
TAGAACAGGAAGAGCAGGAGCAACGTAATAGATAAATAAATAAATAAATTATTTGTGCAT
TTAAATTAAGAATAAAAAATAAATTATTTTATTATTATTATTTAAAATTAATATTATTTA
TTTATATTTAGAGATGGCACTGCATATAGTCTGATATTAATGAGTGAAAGTAAATTCGCA
TCAGATATGCTAAAAGTTATGGAAATAAGCGGTTAGCCTGTCCCACCTAATTTAGAAGAA
GTAGCCATGAATGATGATTAATTTAAAGCATAGCGCTTGGCTACAAAGCTAGGTGTTGAC
TTTGCCAAGGGAAAAGATTCTTCTAAGCTATTAAAATAAGCTCTTTCTAGATAAAGAAAC
ACAAAACATGGACTTGGCTACAAGCAAGAAGATGAACTAAGTATAAAAGACTAAATTAAG
GCTGATGTTGATTAGGATATTAAAAAACAAAAAATATCACAAACTCAAGCACCACCTCCT
CCATTATTTGATTTAGAATAGTTGATTAGCTAAAAAGATCTACTTGAATAAGAAGAGCAA
AAATTATTAAAAGAAAAAGAAAAGGCAATATAGACTTAAAAAATAGTTAGAGAGTATTAA
GAGTAGCTGCTACAAACAGGAAAAATAACTTAAGAATAGTTTAACATACAAGCACAATTG
TAATAATTATAAATTAATGAGAAAGAAATAATATTTTAGCAAATATAAGACTAATTACAG
TTTGTTCGTATTTAAATATAGCAGGCTTAAAATTAAAAATCTTCAATTACTTCAAACAGT
TCTAGTAGTTAACAATAGTAATAGCAGTAAAATTAGCCAGTATAAAATTAAGTGCCTTAG
AGATAGTCTAGAGAGAGTATAATGGAAAATTTTAGAGATCAGATGAAAAAAGGCATGTAA
TAATAATTCAGAAGTGGATTTGTGAGTGGAGGAATGCTTCAGAAAAAAAGTAATTTTATT
TATAAAAGAATAAGATATATTTGAACTTTTTTATTATTTTTTAAAATTTAGAGTGA