Identifiers and Description

Gene Model Identifier

TTHERM_00991550

Standard Name

DRH39 (DExD/H box RNA helicase 39)

Aliases

PreTt07847 | 185.m00068

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF01485 ) IBR domain
  • ( TIGR01612 ) rhoptry protein
  • ( PF04000 ) Sas10/Utp3/C1D family
  • ( PF00096 ) Zinc finger, C2H2 type
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01967 ) ATP-dependent helicase HrpA
  • ( TIGR01970 ) ATP-dependent helicase HrpB
  • ( PF00357 ) Integrin alpha cytoplasmic region
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF01672 ) Putative plasmid partition protein
  • ( PF05377 ) Flagella accessory protein C (FlaC)
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF07717 ) Domain of unknown function (DUF1605)
  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF07599 ) Protein of unknown function (DUF1563)
  • ( TIGR02300 ) conserved hypothetical protein TIGR02300

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00991550

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02917.19.997093137033517e-262helicase domain-containing pro
tein (2060 aa)
OxytrichaContig12082.0.g382.000597631390999e-64Helicase associated domain (HA
2)
DictyBaseDDB_G02701102.9995010303521745e-64dhx33 on chromosome: 1 positio
n 4244035 to 4246332
SGDYGL120C9.004195835458823e-61PRP43 RNA helicase in the DEAH
-box family, functions in both
RNA polymerase I and polymera
se II transcript metabolism, i
nvolved in release of the lari
at-intron from the spliceosome
WormBaseWBGene000189671.0003503620230312e-57locus:ddx-15 Putative pre-mR
NA-splicing factor ATP-depende
nt RNA helicase F56D2.6 stat
us:Confirmed UniProt:Q20875
protein_id:CCD63138.1
Stentor CoeruleusSteCoe_90951.7587922024243116e-25

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00991550(coding)
ATGGATTCAAATTTAAAAGAAAATAATTGTTATATAGTTAATGAGGGCGTAGAAAACGAA
ATGCTCAGTGCTTCATATGTAATATAGAAATTAGAATAGGAATTGATCAATCCATTAAAA
TATTTTGAAGAGTGCACCTATAAAGATATTATCAAAATCAAATCTTTTGAGTAGAATTAA
AAATAATGTATTCCAGAAGTGAAACAAAATTTTAGGCGATGCAAGATTTTTAATAAAGAT
ATTGATATTTTACTAAATATTGATAAGTAGAGTAATTATAATAATACATAGCATGAAGCT
AATAAAAAGGAAGAACATTAAATTGTTTCAGAAGGAAGTTCAGAGATTTCTGATTCATCA
TAAAATTAAAATCTAAACAATGAATCTAAATACTTAAGTTCACAGAACATATCTTGTTCT
GAAGCAGAAAGCGAAGAATCTGAAACAATGCATACGGAGTTAGAAGACATGTAAAATATT
AATCAAGACTTGGACGTGGATGATGATAATGATGATGATGATGATGATGATGATGATGAT
GATGATGATGATATTAACACTGTAACTACCTAACCTCTACTTGAAGAGGAGTAAATTGAC
ATTTAAGGGCTTTAGGATAACAAAGAAGTAGAAGAAGAGTAGAAAGTTAATAACGAAATC
TAATAAATAAGTATATAAAAAGGTGATCTTACCTAAAATGCTACAATCGAGGAACTAAAT
AAAGAAGAATATTTGGACAAGACAAATTTATATGAAATTAATAATTTGAATGATTTTTAG
GAATATTTAATTAAGAATATTGAGTAAAATGTTGATTTAAATGAATAAATTCTTCAAAAA
TTAGAGCTTGTTGACAACAAAGAACAAATTAAAAGCTACTTAAACTAAGTTTGCATAACT
ATAGCTCACTGGAATCTAATATACATCGTGCAAAAATTGAATTTAGATTATTAATAATAA
TAATAATTATAGTAATAATAAAATATAAGAAATAATTATTCCAAATTTTAGAGAGAGCCA
TTAAAAGATTAGATTAGATTTTTTTAGGATTTAAATGAATTTTATAGGAATCATATTTAC
TTTAATGAATTTACTTATTATTCAACTTGTTAGAAGGAATATTTTGAAGCTTTAATAGAC
TAATTTTTAGATTTTTATATTAAACAGTAACAAGAAATTAAGATTTATGAAAAAGAATAT
TAAAATTTAATTCCAATAAAACTTTACATCAAAATAGAAAAGTTTAAATTATTTAATTAA
TTCTTTTTACAGTAACTCAATAGTTTAATTCAAGAGATTTAAAAAAATGATTCTAATCAG
CCTTCTTTATCAGACAAAATATTTTGTATATTTCTTTTTACTAAATCAATTAAATTCGAA
ATTGAACTTTACATAAAGTAGCTGCCATCTTACTCAGCAAAATATAGCATTTAAAGTTAA
ATTTATGACAATTAAGATAGCAAAGTTTAATTGTTGATGGGACATACTGGAAGTGGTAAG
TCAACTTAAGTGCCTCAAATGCTTTTTGCTTTAAATAATTTGTACCTAAAAAGTAAATAT
CTGACAAATAAAACCAAAGAAAATGTTATATTTTGTGTGTAGCCTAGAAGATTAGCTTGC
AAAATGCTATATGAAAGAGTTCAAAACGAAATGTACGAATATGGATATCAGGTTGGTTAC
TATATAGGCAATTTAAAACCCTAATAAAATTATTAAAAAAAGCAAATAGTTTTTATAACT
GAATAGATTTTTATAGATGAATTTGTGAAATACTAGAAAGGATAAAAGTCAATCCTTAGC
TAATGCTCTCATGTGATTATTGATGAAGTACATGAAAGAAATCTAAAAACTGATATTATC
ATTGGATTAATTCATAGATCTCTAACTAACTCTAAATTAAATAAAAGCGGGATCAACTTT
ATACTATCGTCTGCAACAATAAACAAAGAATCTTTTTAGAAGTACTTTTCAAAAAATAAT
CTGAAAATTATTGAGATTTAAGGCCACTCTTACGATGTTAAAGTTGAATACTTGGATAGC
ACTTACTAAAATAAAAGTATGAAGGACAAAATTCTTGATTAGCTTGAAAAAATTATTGAA
ATGAATAACTAAGATTCATTTATAGAAGCAGAGTTTTAAGGTCATATCTTAATATTTCTT
TAAGACTAAATAGAAATAAATGCAATTTTAGATGAGGCTGATAAACTTTTAAAAAATAAA
AAAATTTACAATAAAAATTATGAAATCATGCAATTACATGGTAAAATGCATCAAAGCGAT
ATTTAGAAAGTTTTTGAGTAGAGAGAAAGAGTGACAAAAATAATTTTTTCAACAAATATT
GCTGAGGCTTCGATTACAATAGAAGGAGTAAGTGTTATTTTAGATTCTGGTTTAGAGAAG
ACAATAATATTTGATCCCAGCAGAAACTCAAATGTGCTTACTGTTTAAAATATATCTAAA
TCTCAGGCTGAGTAGAGGAAAGGCAGAGCTGGTCGTACACGCGAGGGAATATGCTATAGG
TTGTATACTTAGGAGCAATATTAAAGGTTTGAAATTGATAAGCAACCTGAAATTATGAGA
TCTAATTTAGGGTTTGCTATTTTGAAGATCATTGAAGTAGGTGTTTAAGACATAAAATAA
TTCGAATTCCTTACTAAACCCAGTTATAGTTTAATACAAAATAGCTTAAACACTCTTGAA
GCATTAGAGGCGATAGTAATAAATAAAAATCTTTGCAAATTGACGGAAATAGGAAAGTGC
ATTATTCAGACTAATTTGGAACCAACTATTGCCAGAATATTCATTAAGGCAATATTTTTA
GGAGTCTTAGATGAAGTAGTGAAAGCGATGGCTGTTTATTCTGAATATAATAATATATTT
TCCAACTCTTAAGTTAGTAGAGATTTATTTAAAGCAATCATGAATGACTATGAATTTTAA
AATCATAAATAAAAAAATTATGATCAAAATTAGAACCAAATAAATTAGTACAACAGTGAT
TTTGTTTTTATGTGGATTACCTTTGAATATTTAAAAAGATAGTAACAAAGACAAATAGAA
AGAAGACAACAGTATGCAAATAAAAACATTAATTATACATTCAAAAAAGTTAATGAATAC
TACCAAGAAGCCATGCAATCTATTTAAGATTTATTTAAATATTTAAAAAAGCGCTTTTCA
CTCCTTAAAGAATAAGATTCTAGTGAAGTAGGATAAATAGCTAAAGGTTTAAAGAATGGC
TATGTGGCTAAATAGTTAATTCAATAAAAATATGATAACATTGTTTATGCTTTTTTCTCT
GGATTTTCCAGTTAGTTAGCCATTTACACGGGAATACATAAGCTAGGATTTTTGAACATT
CAAACAAATGTCTTGTTTTATGTTCATCCTTCGTCATCTCTAAATTATTAGAAAAACAGC
AAATAAACAAATAGGGTATTCTAAAAAGGTTAAATACTCTTTTTTTCAGTTTTGGAAGAA
AGAGAAGTAAACAATTTTGCTAAATTTGTTTCCTTTCTGAATGAAGATTGGATAAAAGAT
TAATAAACTATTTAAAATATGAAAGATAAATCCAACTATTAACCATATATCAAGTTGAAT
GGAGAAAGACCATTGTTGGAGTATTTCTCAAGAAATCAGTTTTTAAATATTTAATAATAA
TTAGATAAAATGGATATACCTAAGAAGGCTAAATATTGTGTACTTTTTGAAAAAGATAAA
GGTTATATCCGCTTTTTTTGCAACTAAGAAATGCAGCAATGTATGGACAGCTTAAATATT
CCTCAGATTTTTCAAGAAAGCAAAGACTAATATTTAAAAGAACAAAAAAATGAGTAAATT
CTAATTAGGTACAAAGACAGTTTTAATTATGCTTTGATAAGAAATGGTCTCACTATCAAA
AAGCTCATTCTTCCTCATGAATTCCTTAGAGTTAGTTTAATAGATATCCCATTCAAAAGT
AACTAGTAAAGCATAAACAATTTAGTGCAGCAAATTGAAGACAATAAATTAAGATAGTAT
AAGGAAGTTAAAATCATTAAAGATTACATTAGCTAAACAGCTGTTGCTTTATTTATTTTC
AAGAACACTAAAAAAGCATTTGCTTTTTACGAAGCTTTGACAAAAATGAAGAGAAGTAAA
ATTGCAGAATTGCTGTCAGCAGAGGATAATTAGCTACCGAGAATAGTTCCTTAGCCTGAA
TGCGAATTTTATATAGAATAAATTAAAAATTTATCTAAATCTGTACTAAGAGCTCAATGG
AGTATATGTGAATCACTTTGCTTCGGTAATATGTACTTCAGTAACGAAGTGGATGTCTTG
GCGACCTATGATTAAATGAAAAAAGCCAATTTGTTTAAAGTAAAATACAATATCAAAGAA
GATGCTAACAGTGGAAATTTAATTCATATCTTAGCCTTAGACAAGCTTGATCCTCTTACC
GATGAAATAGATTTATAATCCTATGTTGTTAACACCTACTAAGGTTATTTATCTTGTGAA
ATTAAGAGAGAAATAATCGATCTTTCCATTTAGCATAACATAGACTTGGAAGAAGCTAGG
TAAAAGAGAAATCTTTAAAATTTAATCTAAGACACAATTAACGAATTTAATTTCTTAAAT
ACCAAGCAGAGCGTTAAAAGTTAAAAATTTTAAAAAGGCTAACAAAAATATTAAGAAGCT
AAAGAAAATATATAAATAAAATTAAAAATACACAATGGTGTTTGCAAGGCAGAGATTATG
CTTGACTCTCATGTATATGCTCAAGAGCTTGTCAATAAGTTTGATGGCATTGAATTTGAA
TGCCAAAGGCTTCGTATGTAAATACAAAATTAATAAAAAATTTTGGTTTTGGGTGCTGTT
TACTTATTTTACTATGACAATATTCGCTAGTATATTGATGAGGCAGGATAAAGTGTTCAA
GTCATTGCTCCTAAATACGATAAAGTATTTTATCTATCTAAAACGGTAGAGATTATTACA
AAATAAATTTACTCAAGCTCAAGTTAGATTTTTTAAAAGCTAAACTACTAAATTACCAAT
CTCATTAAACCTGATTTAATTTATTTAAATTGTCTTCCACTTGATCTAGAAAATTTGATG
AATCAGCAAAGTAATATAGTAGAAGGCATGGAAAAATAATACGAATGCATAATCAAGCTA
TCAGGAAAAAGAAGCTCACAGCTTAAAGTTTGGTTTAGAAAGGATAAAACAGGTGATCAA
ATAGCTTCAGAAAAGACGAAAATTAAATAAGTATTTGAGGAATACTTATTCTAAAAATTC
AAATTTAACAAACAAAATTATCATTTTAAATAAGTTGAAGATTATTTACAAAATATGCAA
AAAAAAAATATCATACAAAGCTATGAATAAGATAATAAAAACTTTACAATCACAGCTACA
AAAAGCTAAATTTAAAAAATTTAACAAGAAATTAATGACAAGAATAAAAAATATCTTAAT
AAGTAGAAATCAAAAGTCGAACAACAAGATGATCTTGAGGAGGAAGAAACTTGTTAGATT
TGTTAAGAATTTAAAAATCTTTAAAGATTCTCATGTGAGTGCTTATTTTGTAAAGAATGT
ATCTCTTTATTCTTTTTAACTCAATCCTAACAGTTCCAAAGCACAAAGCCCTTAGCCTGT
CCAAATCACCAAGATTAGCCTGTCAGTATTAAATTAATTGAATCTATTTTAGATCCCCAG
CAATTATAAGAACTCATTTAATTAAGAATTGATCACTCTATTGAGAATATGATTCACCCT
ACAATACAAAAATAAAATTACATAAGATGCCCATCTGTAAATTGCAATCAGTTTTTTGAA
AGAATATATCCAAAAGAACAAGAAGATAAAGAGCAATTATCTAATGGCATACTCTCTTCC
AATTCAGAAACTTTTGAAGAAATTCCAATATAAAAAAAAGGTTCTAAGATACAAGAGGAG
TTGTCAGCCACCGAAAATTTTGGGATAGCCCCTAGAAGAGTTAAATGCTATGGCTGTTTC
CAAGAATACTGTCTAATTTCTTCAGGAAAATATTTTGAAGAACCAGAAAAATAAATACAT
AATACCCATTCAGAGAGTACATGTGAGCAATATTTTAAGCAATTATAATAAGACAAAGAA
AATCTAAAGGGTATCGAACTTATCACATGCCCAAAATGTAATTTTAAAGCCACTAAGGGA
GAAGGCTGTAATCACATAACCTGTAAATGCGGAGCTCATTTCTGTGCAAAATGCCTTAAA
TAATTTAAAACCTCGAAAGAAGTGTATTAACATTTAGATAAAGAACATCAAGGATATTAC
AATTGA


>TTHERM_00991550(protein)
MDSNLKENNCYIVNEGVENEMLSASYVIQKLEQELINPLKYFEECTYKDIIKIKSFEQNQ
KQCIPEVKQNFRRCKIFNKDIDILLNIDKQSNYNNTQHEANKKEEHQIVSEGSSEISDSS
QNQNLNNESKYLSSQNISCSEAESEESETMHTELEDMQNINQDLDVDDDNDDDDDDDDDD
DDDDINTVTTQPLLEEEQIDIQGLQDNKEVEEEQKVNNEIQQISIQKGDLTQNATIEELN
KEEYLDKTNLYEINNLNDFQEYLIKNIEQNVDLNEQILQKLELVDNKEQIKSYLNQVCIT
IAHWNLIYIVQKLNLDYQQQQQLQQQQNIRNNYSKFQREPLKDQIRFFQDLNEFYRNHIY
FNEFTYYSTCQKEYFEALIDQFLDFYIKQQQEIKIYEKEYQNLIPIKLYIKIEKFKLFNQ
FFLQQLNSLIQEIQKNDSNQPSLSDKIFCIFLFTKSIKFEIELYIKQLPSYSAKYSIQSQ
IYDNQDSKVQLLMGHTGSGKSTQVPQMLFALNNLYLKSKYLTNKTKENVIFCVQPRRLAC
KMLYERVQNEMYEYGYQVGYYIGNLKPQQNYQKKQIVFITEQIFIDEFVKYQKGQKSILS
QCSHVIIDEVHERNLKTDIIIGLIHRSLTNSKLNKSGINFILSSATINKESFQKYFSKNN
LKIIEIQGHSYDVKVEYLDSTYQNKSMKDKILDQLEKIIEMNNQDSFIEAEFQGHILIFL
QDQIEINAILDEADKLLKNKKIYNKNYEIMQLHGKMHQSDIQKVFEQRERVTKIIFSTNI
AEASITIEGVSVILDSGLEKTIIFDPSRNSNVLTVQNISKSQAEQRKGRAGRTREGICYR
LYTQEQYQRFEIDKQPEIMRSNLGFAILKIIEVGVQDIKQFEFLTKPSYSLIQNSLNTLE
ALEAIVINKNLCKLTEIGKCIIQTNLEPTIARIFIKAIFLGVLDEVVKAMAVYSEYNNIF
SNSQVSRDLFKAIMNDYEFQNHKQKNYDQNQNQINQYNSDFVFMWITFEYLKRQQQRQIE
RRQQYANKNINYTFKKVNEYYQEAMQSIQDLFKYLKKRFSLLKEQDSSEVGQIAKGLKNG
YVAKQLIQQKYDNIVYAFFSGFSSQLAIYTGIHKLGFLNIQTNVLFYVHPSSSLNYQKNS
KQTNRVFQKGQILFFSVLEEREVNNFAKFVSFLNEDWIKDQQTIQNMKDKSNYQPYIKLN
GERPLLEYFSRNQFLNIQQQLDKMDIPKKAKYCVLFEKDKGYIRFFCNQEMQQCMDSLNI
PQIFQESKDQYLKEQKNEQILIRYKDSFNYALIRNGLTIKKLILPHEFLRVSLIDIPFKS
NQQSINNLVQQIEDNKLRQYKEVKIIKDYISQTAVALFIFKNTKKAFAFYEALTKMKRSK
IAELLSAEDNQLPRIVPQPECEFYIEQIKNLSKSVLRAQWSICESLCFGNMYFSNEVDVL
ATYDQMKKANLFKVKYNIKEDANSGNLIHILALDKLDPLTDEIDLQSYVVNTYQGYLSCE
IKREIIDLSIQHNIDLEEARQKRNLQNLIQDTINEFNFLNTKQSVKSQKFQKGQQKYQEA
KENIQIKLKIHNGVCKAEIMLDSHVYAQELVNKFDGIEFECQRLRMQIQNQQKILVLGAV
YLFYYDNIRQYIDEAGQSVQVIAPKYDKVFYLSKTVEIITKQIYSSSSQIFQKLNYQITN
LIKPDLIYLNCLPLDLENLMNQQSNIVEGMEKQYECIIKLSGKRSSQLKVWFRKDKTGDQ
IASEKTKIKQVFEEYLFQKFKFNKQNYHFKQVEDYLQNMQKKNIIQSYEQDNKNFTITAT
KSQIQKIQQEINDKNKKYLNKQKSKVEQQDDLEEEETCQICQEFKNLQRFSCECLFCKEC
ISLFFLTQSQQFQSTKPLACPNHQDQPVSIKLIESILDPQQLQELIQLRIDHSIENMIHP
TIQKQNYIRCPSVNCNQFFERIYPKEQEDKEQLSNGILSSNSETFEEIPIQKKGSKIQEE
LSATENFGIAPRRVKCYGCFQEYCLISSGKYFEEPEKQIHNTHSESTCEQYFKQLQQDKE
NLKGIELITCPKCNFKATKGEGCNHITCKCGAHFCAKCLKQFKTSKEVYQHLDKEHQGYY
N


>TTHERM_00991550(gene)
ATGGATTCAAATTTAAAAGAAAATAATTGTTATATAGTTAATGAGGGCGTAGAAAACGAA
ATGCTCAGTGCTTCATATGTAATATAGAAATTAGAATAGGAATTGATCAATCCATTAAAA
TATTTTGAAGAGTGCACCTATAAAGATATTATCAAAATCAAATCTTTTGAGTAGAATTAA
AAATAATGTATTCCAGAAGTGAAACAAAATTTTAGGCGATGCAAGATTTTTAATAAAGAT
ATTGATATTTTACTAAATATTGATAAGTAGAGTAATTATAATAATACATAGCATGAAGCT
AATAAAAAGGAAGAACATTAAATTGTTTCAGAAGGAAGTTCAGAGATTTCTGATTCATCA
TAAAATTAAAATCTAAACAATGAATCTAAATACTTAAGTTCACAGAACATATCTTGTTCT
GAAGCAGAAAGCGAAGAATCTGAAACAATGCATACGGAGTTAGAAGACATGTAAAATATT
AATCAAGACTTGGACGTGGATGATGATAATGATGATGATGATGATGATGATGATGATGAT
GATGATGATGATATTAACACTGTAACTACCTAACCTCTACTTGAAGAGGAGTAAATTGAC
ATTTAAGGGCTTTAGGATAACAAAGAAGTAGAAGAAGAGTAGAAAGTTAATAACGAAATC
TAATAAATAAGTATATAAAAAGGTGATCTTACCTAAAATGCTACAATCGAGGAACTAAAT
AAAGAAGAATATTTGGACAAGACAAATTTATATGAAATTAATAATTTGAATGATTTTTAG
GAATATTTAATTAAGAATATTGAGTAAAATGTTGATTTAAATGAATAAATTCTTCAAAAA
TTAGAGCTTGTTGACAACAAAGAACAAATTAAAAGCTACTTAAACTAAGTTTGCATAACT
ATAGCTCACTGGAATCTAATATACATCGTGCAAAAATTGAATTTAGATTATTAATAATAA
TAATAATTATAGTAATAATAAAATATAAGAAATAATTATTCCAAATTTTAGAGAGAGCCA
TTAAAAGATTAGATTAGATTTTTTTAGGATTTAAATGAATTTTATAGGAATCATATTTAC
TTTAATGAATTTACTTATTATTCAACTTGTTAGAAGGAATATTTTGAAGCTTTAATAGAC
TAATTTTTAGATTTTTATATTAAACAGTAACAAGAAATTAAGATTTATGAAAAAGAATAT
TAAAATTTAATTCCAATAAAACTTTACATCAAAATAGAAAAGTTTAAATTATTTAATTAA
TTCTTTTTACAGTAACTCAATAGTTTAATTCAAGAGATTTAAAAAAATGATTCTAATCAG
CCTTCTTTATCAGACAAAATATTTTGTATATTTCTTTTTACTAAATCAATTAAATTCGAA
ATTGAACTTTACATAAAGTAGCTGCCATCTTACTCAGCAAAATATAGCATTTAAAGTTAA
ATTTATGACAATTAAGATAGCAAAGTTTAATTGTTGATGGGACATACTGGAAGTGGTAAG
TCAACTTAAGTGCCTCAAATGCTTTTTGCTTTAAATAATTTGTACCTAAAAAGTAAATAT
CTGACAAATAAAACCAAAGAAAATGTTATATTTTGTGTGTAGCCTAGAAGATTAGCTTGC
AAAATGCTATATGAAAGAGTTCAAAACGAAATGTACGAATATGGATATCAGGTTGGTTAC
TATATAGGCAATTTAAAACCCTAATAAAATTATTAAAAAAAGCAAATAGTTTTTATAACT
GAATAGATTTTTATAGATGAATTTGTGAAATACTAGAAAGGATAAAAGTCAATCCTTAGC
TAATGCTCTCATGTGATTATTGATGAAGTACATGAAAGAAATCTAAAAACTGATATTATC
ATTGGATTAATTCATAGATCTCTAACTAACTCTAAATTAAATAAAAGCGGGATCAACTTT
ATACTATCGTCTGCAACAATAAACAAAGAATCTTTTTAGAAGTACTTTTCAAAAAATAAT
CTGAAAATTATTGAGATTTAAGGCCACTCTTACGATGTTAAAGTTGAATACTTGGATAGC
ACTTACTAAAATAAAAGTATGAAGGACAAAATTCTTGATTAGCTTGAAAAAATTATTGAA
ATGAATAACTAAGATTCATTTATAGAAGCAGAGTTTTAAGGTCATATCTTAATATTTCTT
TAAGACTAAATAGAAATAAATGCAATTTTAGATGAGGCTGATAAACTTTTAAAAAATAAA
AAAATTTACAATAAAAATTATGAAATCATGCAATTACATGGTAAAATGCATCAAAGCGAT
ATTTAGAAAGTTTTTGAGTAGAGAGAAAGAGTGACAAAAATAATTTTTTCAACAAATATT
GCTGAGGCTTCGATTACAATAGAAGGAGTAAGTGTTATTTTAGATTCTGGTTTAGAGAAG
ACAATAATATTTGATCCCAGCAGAAACTCAAATGTGCTTACTGTTTAAAATATATCTAAA
TCTCAGGCTGAGTAGAGGAAAGGCAGAGCTGGTCGTACACGCGAGGGAATATGCTATAGG
TTGTATACTTAGGAGCAATATTAAAGGTTTGAAATTGATAAGCAACCTGAAATTATGAGA
TCTAATTTAGGGTTTGCTATTTTGAAGATCATTGAAGTAGGTGTTTAAGACATAAAATAA
TTCGAATTCCTTACTAAACCCAGTTATAGTTTAATACAAAATAGCTTAAACACTCTTGAA
GCATTAGAGGCGATAGTAATAAATAAAAATCTTTGCAAATTGACGGAAATAGGAAAGTGC
ATTATTCAGACTAATTTGGAACCAACTATTGCCAGAATATTCATTAAGGCAATATTTTTA
GGAGTCTTAGATGAAGTAGTGAAAGCGATGGCTGTTTATTCTGAATATAATAATATATTT
TCCAACTCTTAAGTTAGTAGAGATTTATTTAAAGCAATCATGAATGACTATGAATTTTAA
AATCATAAATAAAAAAATTATGATCAAAATTAGAACCAAATAAATTAGTACAACAGTGAT
TTTGTTTTTATGTGGATTACCTTTGAATATTTAAAAAGATAGTAACAAAGACAAATAGAA
AGAAGACAACAGTATGCAAATAAAAACATTAATTATACATTCAAAAAAGTTAATGAATAC
TACCAAGAAGCCATGCAATCTATTTAAGATTTATTTAAATATTTAAAAAAGCGCTTTTCA
CTCCTTAAAGAATAAGATTCTAGTGAAGTAGGATAAATAGCTAAAGGTTTAAAGAATGGC
TATGTGGCTAAATAGTTAATTCAATAAAAATATGATAACATTGTTTATGCTTTTTTCTCT
GGATTTTCCAGTTAGTTAGCCATTTACACGGGAATACATAAGCTAGGATTTTTGAACATT
CAAACAAATGTCTTGTTTTATGTTCATCCTTCGTCATCTCTAAATTATTAGAAAAACAGC
AAATAAACAAATAGGGTATTCTAAAAAGGTTAAATACTCTTTTTTTCAGTTTTGGAAGAA
AGAGAAGTAAACAATTTTGCTAAATTTGTTTCCTTTCTGAATGAAGATTGGATAAAAGAT
TAATAAACTATTTAAAATATGAAAGATAAATCCAACTATTAACCATATATCAAGTTGAAT
GGAGAAAGACCATTGTTGGAGTATTTCTCAAGAAATCAGTTTTTAAATATTTAATAATAA
TTAGATAAAATGGATATACCTAAGAAGGCTAAATATTGTGTACTTTTTGAAAAAGATAAA
GGTTATATCCGCTTTTTTTGCAACTAAGAAATGCAGCAATGTATGGACAGCTTAAATATT
CCTCAGATTTTTCAAGAAAGCAAAGACTAATATTTAAAAGAACAAAAAAATGAGTAAATT
CTAATTAGGTACAAAGACAGTTTTAATTATGCTTTGATAAGAAATGGTCTCACTATCAAA
AAGCTCATTCTTCCTCATGAATTCCTTAGAGTTAGTTTAATAGATATCCCATTCAAAAGT
AACTAGTAAAGCATAAACAATTTAGTGCAGCAAATTGAAGACAATAAATTAAGATAGTAT
AAGGAAGTTAAAATCATTAAAGATTACATTAGCTAAACAGCTGTTGCTTTATTTATTTTC
AAGAACACTAAAAAAGCATTTGCTTTTTACGAAGCTTTGACAAAAATGAAGAGAAGTAAA
ATTGCAGAATTGCTGTCAGCAGAGGATAATTAGCTACCGAGAATAGTTCCTTAGCCTGAA
TGCGAATTTTATATAGAATAAATTAAAAATTTATCTAAATCTGTACTAAGAGCTCAATGG
AGTATATGTGAATCACTTTGCTTCGGTAATATGTACTTCAGTAACGAAGTGGATGTCTTG
GCGACCTATGATTAAATGAAAAAAGCCAATTTGTTTAAAGTAAAATACAATATCAAAGAA
GATGCTAACAGTGGAAATTTAATTCATATCTTAGCCTTAGACAAGCTTGATCCTCTTACC
GATGAAATAGATTTATAATCCTATGTTGTTAACACCTACTAAGGTTATTTATCTTGTGAA
ATTAAGAGAGAAATAATCGATCTTTCCATTTAGCATAACATAGACTTGGAAGAAGCTAGG
TAAAAGAGAAATCTTTAAAATTTAATCTAAGACACAATTAACGAATTTAATTTCTTAAAT
ACCAAGCAGAGCGTTAAAAGTTAAAAATTTTAAAAAGGCTAACAAAAATATTAAGAAGCT
AAAGAAAATATATAAATAAAATTAAAAATACACAATGGTGTTTGCAAGGCAGAGATTATG
CTTGACTCTCATGTATATGCTCAAGAGCTTGTCAATAAGTTTGATGGCATTGAATTTGAA
TGCCAAAGGCTTCGTATGTAAATACAAAATTAATAAAAAATTTTGGTTTTGGGTGCTGTT
TACTTATTTTACTATGACAATATTCGCTAGTATATTGATGAGGCAGGATAAAGTGTTCAA
GTCATTGCTCCTAAATACGATAAAGTATTTTATCTATCTAAAACGGTAGAGATTATTACA
AAATAAATTTACTCAAGCTCAAGTTAGATTTTTTAAAAGCTAAACTACTAAATTACCAAT
CTCATTAAACCTGATTTAATTTATTTAAATTGTCTTCCACTTGATCTAGAAAATTTGATG
AATCAGCAAAGTAATATAGTAGAAGGCATGGAAAAATAATACGAATGCATAATCAAGCTA
TCAGGAAAAAGAAGCTCACAGCTTAAAGTTTGGTTTAGAAAGGATAAAACAGGTGATCAA
ATAGCTTCAGAAAAGACGAAAATTAAATAAGTATTTGAGGAATACTTATTCTAAAAATTC
AAATTTAACAAACAAAATTATCATTTTAAATAAGTTGAAGATTATTTACAAAATATGCAA
AAAAAAAATATCATACAAAGCTATGAATAAGATAATAAAAACTTTACAATCACAGCTACA
AAAAGCTAAATTTAAAAAATTTAACAAGAAATTAATGACAAGAATAAAAAATATCTTAAT
AAGTAGAAATCAAAAGTCGAACAACAAGATGATCTTGAGGAGGAAGAAACTTGTTAGATT
TGTTAAGAATTTAAAAATCTTTAAAGATTCTCATGTGAGTGCTTATTTTGTAAAGAATGT
ATCTCTTTATTCTTTTTAACTCAATCCTAACAGTTCCAAAGCACAAAGCCCTTAGCCTGT
CCAAATCACCAAGATTAGCCTGTCAGTATTAAATTAATTGAATCTATTTTAGATCCCCAG
CAATTATAAGAACTCATTTAATTAAGAATTGATCACTCTATTGAGAATATGATTCACCCT
ACAATACAAAAATAAAATTACATAAGATGCCCATCTGTAAATTGCAATCAGTTTTTTGAA
AGAATATATCCAAAAGAACAAGAAGATAAAGAGCAATTATCTAATGGCATACTCTCTTCC
AATTCAGAAACTTTTGAAGAAATTCCAATATAAAAAAAAGGTTCTAAGATACAAGAGGAG
TTGTCAGCCACCGAAAATTTTGGGATAGCCCCTAGAAGAGTTAAATGCTATGGCTGTTTC
CAAGAATACTGTCTAATTTCTTCAGGAAAATATTTTGAAGAACCAGAAAAATAAATACAT
AATACCCATTCAGAGAGTACATGTGAGCAATATTTTAAGCAATTATAATAAGACAAAGAA
AATCTAAAGGGTATCGAACTTATCACATGCCCAAAATGTAATTTTAAAGCCACTAAGGGA
GAAGGCTGTAATCACATAACCTGTAAATGCGGAGCTCATTTCTGTGCAAAATGCCTTAAA
TAATTTAAAACCTCGAAAGAAGTGTATTAACATTTAGATAAAGAACATCAAGGATATTAC
AATTGA