Identifiers and Description

Gene Model Identifier

TTHERM_00419730

Standard Name

DRH38 (DExD/H box RNA helicase 38)

Aliases

PreTt07103 | 46.m00158 | 3679.m00008

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01967 ) ATP-dependent helicase HrpA
  • ( TIGR01970 ) ATP-dependent helicase HrpB
  • ( PF04408 ) Helicase associated domain (HA2)
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF07717 ) Domain of unknown function (DUF1605)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00419730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_5250
Tetrahymena borealisEI9_11089.19.997093137033517e-262hypothetical protein (783 aa)
OxytrichaContig17487.0.g999.997093137033517e-262Helicase associated domain (HA
2)
SGDYER013W2.0005951135209932e-158PRP22 DEAH-box RNA-dependent A
TPase/ATP-dependent RNA helica
se, associates with lariat int
ermediates before the second c
atalytic step of splicing; med
iates ATP-dependent mRNA relea
se from the spliceosome and un
winds RNA duplexes
DictyBaseDDB_G02911839.998596099208102e-158dhx8 on chromosome: 5 position
5107365 to 5110847
WormBaseWBGene000189674.000899569014317e-153locus:ddx-15 status:Confirme
d UniProt:G8JY03 protein_i
d:CCD63139.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00419730(coding)
ATGTGTTAGAGTTAATATAATTAATAAACAAATTAATTGGTAATTATTGTATTTATTATT
GGTATTGATAAAATGGACCCTTCCTAAAGTATAGAAGATTTTAGGAATAGTTTACCAATT
ACTGAACATAAACAAAAGATTATTGAAATAGTAAAGAATAATTTATTTTGTGTTATTACT
GGTGATACTGGTTCTGGTAAATCTACTCAGCTACCTCAATATATTTTAGATTCATAGGAG
ATTTTAGATGTGCTTAAAGAAAATTAGAAAAAATATGATTTGTAAAACAATAAAAAGTCT
AAGCTTAACCATTTGCATGAAGATAACAAAGTGAGTGTAGTAATTACATAGCCTAGAAGA
GTTGCAGCTATATCGATGGCTAAAAGAATATGTTATGAGAGAAATGTAAGCTTAGGAGAT
GATGTAGGATATACTATTAGATTTGATGATAAAACTTCTTCAAAGACTCATTTAAAATAT
ATGACTGATGGTATCCTTGTCAGAGAATGTCTGCAAGATGATACTCTCAGTAAATATAAT
GTTGTTATATTGGATGAGGCTCACGAAAGAAGTCTGTATACTGATGTTCTTTTTGCTTTA
ATCAAATAGGCTGTAAAAAAAAGATAAGGTTCCTTAAAGTTAATTGTCACATCTGCCACT
CTAAACACTGATTAATTTTCAAAGTTTTTTGATAATTGCCCTGTACTTTCTATGAAAGGA
AAGCTTTATAATGTGGAAGTTAGATACAAGCCTATTTTAATGAATTTGAGGATTGAGGAA
AGTATAAACATTATAATGAAAATTCATTTAAATGAAGGTCCTGGCGATATATTAGTTTTC
TTAACTGGATCAGAAGAATGTGAAATAGCAAAGAATTAATGTATAGAGAGGTTATAAAAA
GATTTAGAGAATGGAGTTGAGTTAGCAGGCATGATGATATTTTCACTTTATGGATCATTA
GGTTCAGAAGACTAGCAATAAATATTTATGAAAACTCCTGAAAATTGCAGAAAAGTAGTG
TTTTCAACAAACATAGCAGAAACATCTCTTACTATTGATAACATAGGATTTGTAATAGAT
TGTGGATATGTAAAATAAAAGTGCTATAACCCAAGGACAGGTATGGATGCTTTGATAGTA
GTTCCTATTTCATAAGTTCAAGCAGTGTAAAGAACTGGTAGAGCTGGTAGAACATAAGAA
GGTCTTTGTTTTAGACTTTACAGTAAAAAATTTTATGATGAAGACATGAAACCACATACA
GTGCCAGAAATAAAAAGAGTTTCATTGAATAGTGTTGTCTTAACATTAAAGAGTATGGGA
ATACATGATGTAATTAATTTTGATTATATGGAACACCCTGATAGAGAGCAGTTGCTTCAA
GCATTGAAATAACTTTATTTTCTACAGGCTATAGAACAAGATGGAAGAATTACAGATTTG
GGTAAAGAAATGAATAAATTTCCTTTAGAGCCATCCTATGCTAAGTCTCTTCTTACTAGC
TATATGCTCCGTTGCGAAGATGAAATGATAACTTTAGTTGCTTTGCTCTCATCTGAGCAA
ATTTGGAGTAAACCATCAAGAGTTAGAGCATAAGATTATGAAAGGTTTGAAGAATGTTTA
AAAAGATTTGCTGATCCAGACGGAGATCACTTTAGTCTATTAAATATTTACTATTCATGG
AAGAGAAATAAGTGCTCAGATGGGTATGCTAAATCAAACTTCTTTAACATAAGAGCCTTG
AAATAAGGAGAGAATATCAAAATATAAATAAATGACTTAATAAAGAATATTGATAAAGAT
GTTTTAAAAAAATTCTATAAAGAAGATTCTATGTATTTATATTATAAAGAAAATAGAGAA
AAAAAAGATTCAGATTCTAAAAGCAAAAGTAACTCTTAAAAAAAGGAAGATAAATATAAT
GAAAAATTTGATCAAAAAAATTAAAAATAATAAAATCCTGTCTTGACTCAATCTGATATC
TTTAGGTTAGCCTTAGCTAGCGGCTTTTATTATAATAGTGCTAGAAAAGTTTAAAATAGC
ACTGATAGTTATTTGCTTATATATCCAGAAGGAAATGTTGTTGATATAGACCCTCAATCA
GTTTATTCAATAACTTAAAATTATCCTCCTCATGTAATTTTTACAGAACTGGGTGGTACG
AATCAAGTTAGAGGAGTTATGAGATACGTTTCATAGATAGATCCCTTTTGGGTTTCGCCG
TATATACCCATGATAAAGAATGTAAATGCTAAAAGATTAGCGGGATTAGATTAGAATCAA
AATAAATAAGAAATAATTTAGAAGAAAAAAACAGATGAAGAAATATAAAAAGAGAAGTAA
GATAGAATATAAGAAATAGAAGAGAAAAAAAAATAAGCCTTAGCTCGTTTGAATGAGCGC
AAAAAATTATAAAAAAATTGA


>TTHERM_00419730(protein)
MCQSQYNQQTNQLVIIVFIIGIDKMDPSQSIEDFRNSLPITEHKQKIIEIVKNNLFCVIT
GDTGSGKSTQLPQYILDSQEILDVLKENQKKYDLQNNKKSKLNHLHEDNKVSVVITQPRR
VAAISMAKRICYERNVSLGDDVGYTIRFDDKTSSKTHLKYMTDGILVRECLQDDTLSKYN
VVILDEAHERSLYTDVLFALIKQAVKKRQGSLKLIVTSATLNTDQFSKFFDNCPVLSMKG
KLYNVEVRYKPILMNLRIEESINIIMKIHLNEGPGDILVFLTGSEECEIAKNQCIERLQK
DLENGVELAGMMIFSLYGSLGSEDQQQIFMKTPENCRKVVFSTNIAETSLTIDNIGFVID
CGYVKQKCYNPRTGMDALIVVPISQVQAVQRTGRAGRTQEGLCFRLYSKKFYDEDMKPHT
VPEIKRVSLNSVVLTLKSMGIHDVINFDYMEHPDREQLLQALKQLYFLQAIEQDGRITDL
GKEMNKFPLEPSYAKSLLTSYMLRCEDEMITLVALLSSEQIWSKPSRVRAQDYERFEECL
KRFADPDGDHFSLLNIYYSWKRNKCSDGYAKSNFFNIRALKQGENIKIQINDLIKNIDKD
VLKKFYKEDSMYLYYKENREKKDSDSKSKSNSQKKEDKYNEKFDQKNQKQQNPVLTQSDI
FRLALASGFYYNSARKVQNSTDSYLLIYPEGNVVDIDPQSVYSITQNYPPHVIFTELGGT
NQVRGVMRYVSQIDPFWVSPYIPMIKNVNAKRLAGLDQNQNKQEIIQKKKTDEEIQKEKQ
DRIQEIEEKKKQALARLNERKKLQKN


>TTHERM_00419730(gene)
ATGTGTTAGGTATTTTCGTAATAATTTACCAATTTTCTAAATTATATTAATAAATATTTT
ATTTTAATGAAACATGTTTGGAACTCTTATAAATAATATACTCGAATTATAAATTATTAA
TAAACTTTAAACTCAAATGTTACCAAAATTAAATATAAAAATTTCTAAAATGAATTAAAT
AAATAAATAAATAATTCAAAATAATTTTTTTGTTAAATTATTTTAATTTGAAAAAATATT
ATTTTAAAATTTCATTGTGTTATTGCTATGATATGCATTAGAAGAAACTATAATATCTAG
ACAAAGAGTTAATATAATTAATAAACAAATTAATTGGTAATTATTGTATTTATTATTGGT
ATTGATAAAATGGACCCTTCCTAAAGTATAGAAGATTTTAGGAATAGTTTACCAATTACT
GAACATAAACAAAAGATTATTGAAATAGTAAAGAATAATTTATTTTGTGTTATTACTGGT
GATACTGGTTCTGGTAAATCTACTCAGCTACCTCAATATATTTTAGATTCATAGGAGATT
TTAGATGTGCTTAAAGAAAATTAGAAAAAATATGATTTGTAAAACAATAAAAAGTCTAAG
CTTAACCATTTGCATGAAGATAACAAAGTGAGTGTAGTAATTACATAGCCTAGAAGAGTT
GCAGCTATATCGATGGCTAAAAGAATATGTTATGAGAGAAATGTAAGCTTAGGAGATGAT
GTAGGATATACTATTAGATTTGATGATAAAACTTCTTCAAAGACTCATTTAAAATATATG
ACTGATGGTATCCTTGTCAGAGAATGTCTGCAAGATGATACTCTCAGTAAATATAATGTT
GTTATATTGGATGAGGCTCACGAAAGAAGTCTGTATACTGATGTTCTTTTTGCTTTAATC
AAATAGGCTGTAAAAAAAAGATAAGGTTCCTTAAAGTTAATTGTCACATCTGCCACTCTA
AACACTGATTAATTTTCAAAGTTTTTTGATAATTGCCCTGTACTTTCTATGAAAGGAAAG
CTTTATAATGTGGAAGTTAGATACAAGCCTATTTTAATGAATTTGAGGATTGAGGAAAGT
ATAAACATTATAATGAAAATTCATTTAAATGAAGGTCCTGGCGATATATTAGTTTTCTTA
ACTGGATCAGAAGAATGTGAAATAGCAAAGAATTAATGTATAGAGAGGTTATAAAAAGAT
TTAGAGAATGGAGTTGAGTTAGCAGGCATGATGATATTTTCACTTTATGGATCATTAGGT
TCAGAAGACTAGCAATAAATATTTATGAAAACTCCTGAAAATTGCAGAAAAGTAGTGTTT
TCAACAAACATAGCAGAAACATCTCTTACTATTGATAACATAGGATTTGTAATAGATTGT
GGATATGTAAAATAAAAGTGCTATAACCCAAGGACAGGTATGGATGCTTTGATAGTAGTT
CCTATTTCATAAGTTCAAGCAGTGTAAAGAACTGGTAGAGCTGGTAGAACATAAGAAGGT
CTTTGTTTTAGACTTTACAGTAAAAAATTTTATGATGAAGACATGAAACCACATACAGTG
CCAGAAATAAAAAGAGTTTCATTGAATAGTGTTGTCTTAACATTAAAGGTAAATAAATAA
ATATTTTTAAAATATTTTATTTATTGGTTGGATAAGTTTAATAATTATTTTTATTTAATT
TATTAGAGTATGGGAATACATGATGTAATTAATTTTGATTATATGGAACACCCTGATAGA
GAGCAGTTGCTTCAAGCATTGAAATAACTTTATTTTCTACAGGCTATAGAACAAGATGGA
AGAATTACAGATTTGGGTAAAGAAATGAATAAATTTCCTTTAGAGCCATCCTATGCTAAG
TCTCTTCTTACTAGCTATATGCTCCGTTGCGAAGATGAAATGATAACTTTAGTTGCTTTG
CTCTCATCTGAGCAAATTTGGAGTAAACCATCAAGAGTTAGAGCATAAGATTATGAAAGG
TTTGAAGAATGTTTAAAAAGATTTGCTGATCCAGACGGAGATCACTTTAGTCTATTAAAT
ATTTACTATTCATGGAAGAGAAATAAGTGCTCAGATGGGTATGCTAAATCAAACTTCTTT
AACATAAGAGCCTTGAAATAAGGAGAGAATATCAAAATATAAATAAATGACTTAATAAAG
AATATTGATAAAGATGTTTTAAAAAAATTCTATAAAGAAGATTCTATGTATTTATATTAT
AAAGAAAATAGAGAAAAAAAAGATTCAGATTCTAAAAGCAAAAGTAACTCTTAAAAAAAG
GAAGATAAATATAATGAAAAATTTGATCAAAAAAATTAAAAATAATAAAATCCTGTCTTG
ACTCAATCTGATATCTTTAGGTTAGCCTTAGCTAGCGGCTTTTATTATAATAGTGCTAGA
AAAGTTTAAAATAGCACTGATAGTTATTTGCTTATATATCCAGAAGGAAATGTTGTTGAT
ATAGACCCTCAATCAGTTTATTCAATAACTTAAAATTATCCTCCTCATGTAATTTTTACA
GAACTGGGTGGTACGAATCAAGTTAGAGGAGTTATGAGATACGTTTCATAGATAGATCCC
TTTTGGGTTTCGCCGTATATACCCATGATAAAGAATGTAAATGCTAAAAGATTAGCGGGA
TTAGATTAGAATCAAAATAAATAAGAAATAATTTAGAAGAAAAAAACAGATGAAGAAATA
TAAAAAGAGAAGTAAGATAGAATATAAGAAATAGAAGAGAAAAAAAAATAAGCCTTAGCT
CGTTTGAATGAGCGCAAAAAATTATAAAAAAATTGA