Identifiers and Description

Gene Model Identifier

TTHERM_00372500

Standard Name

DRH37 (DExD/H box RNA helicase 37)

Aliases

PreTt28664 | 39.m00237 | 3693.m00083

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00931 ) NB-ARC domain
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01967 ) ATP-dependent helicase HrpA
  • ( TIGR01970 ) ATP-dependent helicase HrpB
  • ( PF04408 ) Helicase associated domain (HA2)
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF07717 ) Domain of unknown function (DUF1605)
  • ( PF08648 ) Protein of unknown function (DUF1777)
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00372500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_168330
WormBaseWBGene000033899.997093137033517e-262locus:mog-1 Probable pre-mRN
A-splicing factor ATP-dependen
t RNA helicase mog-1 status:
Confirmed UniProt:P34498 p
rotein_id:CAA82662.1
Tetrahymena borealisEI9_12297.19.997093137033517e-262hypothetical protein (1133 aa)
DictyBaseDDB_G02858439.997093137033517e-262helD on chromosome: 4 position
3861549 to 3865824
OxytrichaContig18937.0.g1109.997093137033517e-262Helicase associated domain (HA
2)
SGDYKR086W9.997093137033517e-262PRP16 DEAH-box RNA helicase in
volved in second catalytic ste
p of splicing; exhibits ATP-de
pendent RNA unwinding activity
; mediates the release of Yju2
p and Cwc25p in the second ste
p; in the absence of ATP, stab
ilizes the binding of Cwc25p t
o the spliceosome in the first
catalytic step

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00372500(coding)
ATGTCTTCAAAAGACAAAAAAACAGATAAAAGAAGAAGTCGTTCTCGAAGTTACGAAAAA
GACAACAGTCGTAAATCAGATTATTCCAATAGATCAAGTAAAAATAGTGGATCTTCTAGT
TATAGGGGTAGTAGATATGATGATGAACAAAGCGATTATAAAGATAAGTAAAGTCAATCT
TCATTAAAAGATTACTCTAGGCCATCAAAGTATAGCTAATCTGAAAAAAGAAGAGAAAGG
TCAAGTCGTTCACGTTCACGCTCAAACGAAAGAAATGATAAAGGAAGTAGGACATCAAAA
TATAATAATAGCTATGAAAAAGGATCTTCATCATCATATACATAATCAACATAGCAATCA
ACTAACAAAAGAGATACTGGAACAAAAGAAAATCCAGCATATAAACTCTCAAGCGGACCT
GTAATGTTTGTTGGTTCAAAAGGAGCAACATTAGTCAAAAAAACTCCTTTACCTCCTTCA
AGAAATGCAGAAGGTAATGGAGGAGACCAATTCAAGGCTCCTGCTCCAAGAGGGTAAGGA
GGTTAAACAAATTAGTATTAAGGGTATTAAACTAGTAAAAGACAAAATCGAAATGAAAAT
GAATGGGATGATTATGAAGGTAAAGCAGAATAATACTGGTATGATTAGGATGAAAATGGT
AATTACTTTGATGAAGCTGAAGAGGCTATTTTTGTAGGAGATGAGTAAGCATTTAGAGCC
AAAGAAGAATAATTAGAAATGATGAAATAAAAAAAATAAAATGCAAAACAAAATGAAAAA
AATATGGAAAATGATAAGTGGGATTTCAACAGAATGGTTGCCTCTGGTATATTTAAAATG
AAAGAAGTTAGCTTTGATTTTAATGAAGAAGATGACAATAGAGTTAGTGTCTTGGTGCAC
GATATTAAACCTATATTTTTAGATGGTAAAAATATATACACAAAACAAATTGAATGCGTA
TCAGTAGTTAAGGATGAAAATTCATAAATGGCAATTATTTCTAAAAAGGGTTCAAATGTG
CTCCGTTTCTAAAGAGAAAAAGCAGATAAAACAAAAATGCGTTAACGTTTTTGGGAGTTA
GCAGGTTCTCGTATGGGTTCAATATTAGGAGTAAAAAAAATAGAAGAAAACAAAGATTCT
GCAGATTTTACAGAAGAAGGTGATTTAGATTATAAAAAATCATCTTAATATGCTTCTGCT
TTGATAAAAAAATAGGAATCTGTCAGTGAATTTACACGTACAAAAACTATAAAATAACAG
AGAGAGTATCTTCCTATATATTCTGTAAGAGAAGAGTTGTTAAAAGCAGTAGGTGAGAGT
AAGGTTTTAATTATATCTGGTGAGACTGGTTCTGGTAAAACTACTTAATTAACTTAGTAT
TTATATGAGAGTGATTATGCATCACATGGAAATGGAATGATTGGATGTACTCAACCTCGT
AGAGTTGCAGCAGTTAGTGTTGCAAAAAGAGTAGCTGAAGAAATAGGATGTGAATTAGGA
TAAGAAGTAGGTTATTCTATCCGTTTTGAGGATTGCACTACTAAAAATACAAGAATAAAA
TATATGACTGATGGTGTTCTATTAAGAGAAAGTTTAAATGATCCAGATCTTGAATAATAT
TCTTGCATTATTATGGATGAAGCTCATGAAAGATCTTTAAATACAGATGTTCTTTTTGGT
ATTCTAAAAAAGGTAGCTTAAAGAAGAAGAGATATAAAAATCATTATCACCAGTGCTACT
ATGAACTCTAGAAAATTTAGTGATTTCTTTGATGGAGCATCTATTTTTGAGATTCCAGGT
AGAACATTTCCTGTAGGTATTAGGTTCGATAAGGCAGCAGCTGAAGACTATGTTGATGCA
GCTGTTAAAAAAGCCCTATAAGTTCATATTTAAGAGCCACCAGGAGATATTTTAATTTTT
ATGACAGGACAAGAAGATATTGAAGTAACTTGTTTACTTTTGGCTGAAAAAATAGCAAGC
TAAGAAACAATTCCCCCAATTACAATACTACCTATTTATTCCTAATTGAGATCAGATGAT
CAAGCTAAAATCTTTGAATCATCGAAATAAAGAAAATGTATAGTAGCTACTAATATAGCA
GAAACATCCCTTACACTTGATGGTGTTAGATACGTTATTGATACAGGGTATTGTAAAATT
AAAGTTTACAATCCAAAAATAGGTATGGATGCACTGTAAATAACTCCTATTTCATAAGCA
AATGCTAATTAACGTTCTGGAAGAGCAGGAAGAACTGGTCCTGGTATTTGTTATAGGCTC
TATAGTGATACGAATTTCCGTTCTGATATGCTTGAAAATAACATCCCAGAAATACAGAGA
ACCAATTTGGCTAATGTTGTTTTACTTTTAAAATCTTTAAATATCGACGATCTGTTGTAA
TTTGACTTCATGGATCCTCCTCCATAAGAGACAATCCTTAATTCTATGTATCAGTTGTGG
TTGCTTGGATGCTTGGATGAAGCTGGATCTATCACTGATTTAGGAAGGAAAATGGCTTAA
TTCCCTCTAGATCCTCCTTTAACTAAAATGCTTATAACAGCAGATGAACTTGGCTGTACA
GAAGAAATTTTAACAATAGTCAGTATGCTAAGTGTTCCTTCTGTTTTTTACAGACCAAAA
GGAAGGGAAGAAGAAAGTGATGCTGTTAGAGAGAAACTTTTAATTTCTGAGAGTGACCAT
TTAACACTATTAAATGTATATGAATAATGGAAAAAAAATGACTATTCAGGTTAATGGTGT
AGTGATCACTTTATTTAGGTTAAAACGTTAAGAAAGGTAAGAGAAGTTAGATCATAGCTT
AAAGATATAGCCAAATAACAAAATTTAAAGTTGACCAGCTGTAATTATGATTATGATCTT
GTTAGAAAAGCAATCTGCTCTGCATATTTCACTCATGCTGCAAAGATTAAATCAATTGGA
GAATATACTAATTTACGTACCGCTATGCCTTGCAGAGTGCATCCTTCAAGTGCACTTTTT
ACTCTCGGACATGCACCTGATTATGTAGTTTATCATGAATTAATTATGACAACAAAAGAA
TATATGAGTTGTGTTACTTCAGTAGATCCTAAATGGTTAGAAGAAATGGGTCCTATGTTC
TTTAGTGTAAAAGAATATTATGGACATAGAAGAGATAGATCATAAATTCAAGCTGAAGCT
ACAAATAGAATAGAACTTAGTAATCGTATAGCTCTTGAGAAATAAACAGAAATGAGAATA
AAAAAGTAATAAGAAATGGAATTAGAAAAATAACAGAGGGATTAATTAGTAGAAAGCAGC
AATAAAAAAGCTCCTAAACTGGCTACAGGTAGAAGGATAGCAAATACATCATTACTAAAT
AGAAATATTGATGAAGATTGA


>TTHERM_00372500(protein)
MSSKDKKTDKRRSRSRSYEKDNSRKSDYSNRSSKNSGSSSYRGSRYDDEQSDYKDKQSQS
SLKDYSRPSKYSQSEKRRERSSRSRSRSNERNDKGSRTSKYNNSYEKGSSSSYTQSTQQS
TNKRDTGTKENPAYKLSSGPVMFVGSKGATLVKKTPLPPSRNAEGNGGDQFKAPAPRGQG
GQTNQYQGYQTSKRQNRNENEWDDYEGKAEQYWYDQDENGNYFDEAEEAIFVGDEQAFRA
KEEQLEMMKQKKQNAKQNEKNMENDKWDFNRMVASGIFKMKEVSFDFNEEDDNRVSVLVH
DIKPIFLDGKNIYTKQIECVSVVKDENSQMAIISKKGSNVLRFQREKADKTKMRQRFWEL
AGSRMGSILGVKKIEENKDSADFTEEGDLDYKKSSQYASALIKKQESVSEFTRTKTIKQQ
REYLPIYSVREELLKAVGESKVLIISGETGSGKTTQLTQYLYESDYASHGNGMIGCTQPR
RVAAVSVAKRVAEEIGCELGQEVGYSIRFEDCTTKNTRIKYMTDGVLLRESLNDPDLEQY
SCIIMDEAHERSLNTDVLFGILKKVAQRRRDIKIIITSATMNSRKFSDFFDGASIFEIPG
RTFPVGIRFDKAAAEDYVDAAVKKALQVHIQEPPGDILIFMTGQEDIEVTCLLLAEKIAS
QETIPPITILPIYSQLRSDDQAKIFESSKQRKCIVATNIAETSLTLDGVRYVIDTGYCKI
KVYNPKIGMDALQITPISQANANQRSGRAGRTGPGICYRLYSDTNFRSDMLENNIPEIQR
TNLANVVLLLKSLNIDDLLQFDFMDPPPQETILNSMYQLWLLGCLDEAGSITDLGRKMAQ
FPLDPPLTKMLITADELGCTEEILTIVSMLSVPSVFYRPKGREEESDAVREKLLISESDH
LTLLNVYEQWKKNDYSGQWCSDHFIQVKTLRKVREVRSQLKDIAKQQNLKLTSCNYDYDL
VRKAICSAYFTHAAKIKSIGEYTNLRTAMPCRVHPSSALFTLGHAPDYVVYHELIMTTKE
YMSCVTSVDPKWLEEMGPMFFSVKEYYGHRRDRSQIQAEATNRIELSNRIALEKQTEMRI
KKQQEMELEKQQRDQLVESSNKKAPKLATGRRIANTSLLNRNIDED


>TTHERM_00372500(gene)
ATGTCTTCAAAAGACAAAAAAACAGATAAAAGAAGAAGTCGTTCTCGAAGTTACGAAAAA
GACAACAGTCGTAAATCAGATTATTCCAATAGATCAAGTAAAAATAGTGGATCTTCTAGT
TATAGGGGTAGTAGATATGATGATGAACAAAGCGATTATAAAGATAAGTAAAGTCAATCT
TCATTAAAAGATTACTCTAGGCCATCAAAGTATAGCTAATCTGAAAAAAGAAGAGAAAGG
TCAAGTCGTTCACGTTCACGCTCAAACGAAAGAAATGATAAAGGAAGTAGGACATCAAAA
TATAATAATAGCTATGAAAAAGGATCTTCATCATCATATACATAATCAACATAGCAATCA
ACTAACAAAAGAGATACTGGAACAAAAGAAAATCCAGCATATAAACTCTCAAGCGGACCT
GTAATGTTTGTTGGTTCAAAAGGAGCAACATTAGTCAAAAAAACTCCTTTACCTCCTTCA
AGAAATGCAGAAGGTAATGGAGGAGACCAATTCAAGGCTCCTGCTCCAAGAGGGTAAGGA
GGTTAAACAAATTAGTATTAAGGGTATTAAACTAGTAAAAGACAAAATCGAAATGAAAAT
GAATGGGATGATTATGAAGGTAAAGCAGAATAATACTGGTATGATTAGGATGAAAATGGT
AATTACTTTGATGAAGCTGAAGAGGCTATTTTTGTAGGAGATGAGTAAGCATTTAGAGCC
AAAGAAGAATAATTAGAAATGATGAAATAAAAAAAATAAAATGCAAAACAAAATGAAAAA
AATATGGAAAATGATAAGTGGGATTTCAACAGAATGGTTGCCTCTGGTATATTTAAAATG
AAAGAAGTTAGCTTTGATTTTAATGAAGAAGATGACAATAGAGTTAGTGTCTTGGTGCAC
GATATTAAACCTATATTTTTAGATGGTAAAAATATATACACAAAACAAATTGAATGCGTA
TCAGTAGTTAAGGATGAAAATTCATAAATGGCAATTATTTCTAAAAAGGGTTCAAATGTG
CTCCGTTTCTAAAGAGAAAAAGCAGATAAAACAAAAATGCGTTAACGTTTTTGGGAGTTA
GCAGGTTCTCGTATGGGTTCAATATTAGGAGTAAAAAAAATAGAAGAAAACAAAGATTCT
GCAGATTTTACAGAAGAAGGTGATTTAGATTATAAAAAATCATCTTAATATGCTTCTGCT
TTGATAAAAAAATAGGAATCTGTCAGTGAATTTACACGTACAAAAACTATAAAATAACAG
AGAGAGTATCTTCCTATATATTCTGTAAGAGAAGAGTTGTTAAAAGCAGTAGGTGAGAGT
AAGGTTTTAATTATATCTGGTGAGACTGGTTCTGGTAAAACTACTTAATTAACTTAGTAT
TTATATGAGAGTGATTATGCATCACATGGAAATGGAATGATTGGATGTACTCAACCTCGT
AGAGTTGCAGCAGTTAGTGTTGCAAAAAGAGTAGCTGAAGAAATAGGATGTGAATTAGGA
TAAGAAGTAGGTTATTCTATCCGTTTTGAGGATTGCACTACTAAAAATACAAGAATAAAA
TATATGACTGATGGTGTTCTATTAAGAGAAAGTTTAAATGATCCAGATCTTGAATAATAT
TCTTGCATTATTATGGATGAAGCTCATGAAAGATCTTTAAATACAGATGTTCTTTTTGGT
ATTCTAAAAAAGGTAATTTTTGAGAATTAAATTTTTAAAAAGCTTAAATTTATTTAGAAG
GTTAAAAACATTTAAAAGTAAAGTTTACCTTGTGAATTCTTAAGCTAGCCAACTAACTTA
TTAATCTTTATATAATTTTCTAATACAATCAAATTATATAACTTTAGAGCTTTAGAGTAG
TTTTTGAAATTTAATAGAAATCACTTTCAAAAAATATTTACAAAAATTTTTAATTAAATG
AATAATTTTAATGTTTTAGATTTAAAAGAATACTAAGTAAAATTTTATCTTTTATAGGTA
GCTTAAAGAAGAAGAGATATAAAAATCATTATCACCAGTGCTACTATGAACTCTAGAAAA
TTTAGTGATTTCTTTGATGGAGCATCTATTTTTGAGATTCCAGGTAGAACATTTCCTGTA
GGTATTAGGTTCGATAAGGCAGCAGCTGAAGACTATGTTGATGCAGCTGTTAAAAAAGCC
CTATAAGTTCATATTTAAGAGCCACCAGGAGATATTTTAATTTTTATGACAGGACAAGAA
GATATTGAAGTAACTTGTTTACTTTTGGCTGAAAAAATAGCAAGCTAAGAAACAATTCCC
CCAATTACAATACTACCTATTTATTCCTAATTGAGATCAGATGATCAAGCTAAAATCTTT
GAATCATCGAAATAAAGAAAATGTATAGTAGCTACTAATATAGCAGAAACATCCCTTACA
CTTGATGGTGTTAGATACGTTATTGATACAGGGTATTGTAAAATTAAAGTTTACAATCCA
AAAATAGGTATTTTTTTAAAATACAATTTATTTCTTTAAATAATTTAATTTATTCAAAAT
ATTTTTTAAGGTATGGATGCACTGTAAATAACTCCTATTTCATAAGCAAATGCTAATTAA
CGTTCTGGAAGAGCAGGAAGAACTGGTCCTGGTATTTGTTATAGGCTCTATAGTGATACG
AATTTCCGTTCTGATATGCTTGAAAATAACATCCCAGAAATACAGAGAACCAATTTGGCT
AATGTTGTTTTACTTTTAAAATCTTTAAATATCGACGATCTGTTGTAATTTGACTTCATG
GATCCTCCTCCATAAGAGACAATCCTTAATTCTATGTATCAGTTGTGGTTGCTTGTAATT
TATTTTCTTTTTAAAGAATTTTAATTTAAATATACACATTTATAAAATTAACAGGGATGC
TTGGATGAAGCTGGATCTATCACTGATTTAGGAAGGAAAATGGCTTAATTCCCTCTAGAT
CCTCCTTTAACTAAAATGCTTATAACAGCAGATGAACTTGGCTGTACAGAAGAAATTTTA
ACAATAGTCAGTATGCTAAGTGTTCCTTCTGTTTTTTACAGACCAAAAGGAAGGGAAGAA
GAAAGTGATGCTGTTAGAGAGAAACTTTTAATTTCTGAGAGTGACCATTTAACACTATTA
AATGTATATGAATAATGGAAAAAAAATGACTATTCAGGTTAATGGTGTAGTGATCACTTT
ATTTAGGTTAAAACGTTAAGAAAGGTATAAATAAATTATTTTAAAGTTATTTAAATTTAA
TTTAATTCATATATAAAACATTTAGGTAAGAGAAGTTAGATCATAGCTTAAAGATATAGC
CAAATAACAAAATTTAAAGTTGACCAGCTGTAATTATGATTATGATCTTGTTAGAAAAGC
AATCTGCTCTGCATATTTCACTCATGCTGCAAAGATTAAATCAATTGGAGAATATACTAA
TTTACGTACCGCTATGCCTTGCAGAGTGCATCCTTCAAGTGCACTTTTTACTCTCGGACA
TGCACCTGATTATGTAGTTTATCATGAATTAATTATGACAACAAAAGAATATATGAGTTG
TGTTACTTCAGTAGATCCTAAATGGTTAGAAGAAATGGGTCCTATGTTCTTTAGTGTAAA
AGAATATTATGGACATAGAAGAGATAGATCATAAATTCAAGCTGAAGCTACAAATAGAAT
AGAACTTAGTAATCGTATAGCTCTTGAGAAATAAACAGAAATGAGAATAAAAAAGTAATA
AGAAATGGAATTAGAAAAATAACAGAGGGATTAATTAGTAGAAAGCAGCAATAAAAAAGC
TCCTAAACTGGCTACAGGTAGAAGGATAGCAAATACATCATTACTAAATAGAAATATTGA
TGAAGATTGA