Identifiers and Description

Gene Model Identifier

TTHERM_00700870

Standard Name

DRH36 (DExD/H box RNA helicase 36)

Aliases

PreTt14884 | 109.m00102

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF08146 ) BP28CT (NUC211) domain
  • ( TIGR01389 ) ATP-dependent DNA helicase RecQ
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00700870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01250.19.997093137033517e-262type III restriction enzyme, r
es subunit protein (944 aa)
OxytrichaContig5638.0.g546.002263356957296e-125DEAD/DEAH box helicase
DictyBaseDDB_G02743252.9992439173235726e-110ddx52 on chromosome: 2 positio
n 3957548 to 3959667
SGDYGL171W1.99970314379378e-94ROK1 ATP-dependent RNA helicas
e of the DEAD box family; requ
ired for 18S rRNA synthesis
WormBaseWBGene000110321.9995118794191673e-87status:Confirmed UniProt:Q21
736 protein_id:CAA99891.1
Stentor CoeruleusSteCoe_333806.813556821545298e-46

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00700870(coding)
ATGAAATAGTAGCAATCAATCAAAAAAGTTTCAGGAACTTAGCAAGCATAAAAGGATTCT
AAAAAGAAGTTAAACTTCTTTTAGATTTTGAAGACAGGCACATCATTTTACTAGAAGGAA
GAAAATAATAGATTTTAAAAACAAACAGAAAAAGTAAATTAGGCCGTTAGAGAATCTTCT
TAACCCAAGAGAAAACTTTCTGACAATAACCTAGCATAAAAATATAATGAAAACGATAGT
GATGATAGCGATAATGAAAATCTTAAGCAATTAAATGAACAAATCACTTAAACAAAATCT
CGTAGAAAAATGAGCATAGATGAATTAGAAAAGGATTGGGAACATCAGTAGCAACTTAAG
CAAGCTAAAATCAAAGCATTGATGAAATTGTACAAAGTTAAAGTTGAAGGTGATAATATT
CCACCTCTCTTAACTAATTTCACTAAAATGCAAAAGAAGTATGGATTTAACCAAAAAATA
TTGGATAACATGAAGAAAGCTGGTTATGAAAAGCCTACTCCAATTTAGATGTAATCAGTA
CCAATAATTATGGAAAAAAGAAATTTACTAGCACTTGCTCCTACTGGAAGTGGTAAAACA
GCTGCTTATTGTCTTCCATTGCTCTAGAAACTAGGCACTCATTAAAAAAATGGAGTCAGA
GCTCTCATTTTTGCTCCCTCAAACGAATTGGCAGAGTAAATTTTAAGAGAATTCGAATTC
TTAAATTACGGAGTTGAAGATGGTCTCAGAATCAAATAAATTTAAAAAATAAATAATGAA
TCAAACGCTTTCAAAATATAACTTGAACATATCGATATTTTAATTACTACTCCATTAAAG
TTCATTAAAATGAATAGAAAATCTCATACAGAATTTGATAAGTTAGAATACATTGTATTC
GATGAAGCAGATAGATACTTTGAATTTAACATTGCTGGTTAAATGAAGAGAATTTTAGAA
ACATTTTAAGAAAAGTAAGGGCTAACTTATTTATTATTTAGTGCAACTATTCAACATCCT
GTAGAAGAATTAGTTAAAAATATTATCGTTGATCCATTGAAATTGTAGATTGGAGGTAAA
AATAATGTTTTGGCTTCAATTGAGTAGTCACTTTCTTACTGCTAAAGTGAATATGGCAAA
CTTGTCGAATTAAAAAATATTATTAACAATGGTGAATTTAATCCACCTGTCCTTATTTTT
GTTCAATCTAAAGAAAGAGGAGAGGAATTACTTTCTATGATAAAAAGCTCCTGTGTGAAT
ACACCTATTAAAATAGAAAAGATTGATTCTGATAAGTAGAAAGAAGAAAGAGAAGAAGTT
ATTGAAGATTTTAGAACTGGTAAGTTGTGGGCTTTAATTTGTACAGATTTGATGGCAAGA
GGTATTGACTTTAAGGGAGTTAATTTGGTCATTAATTATGATTTTCCAACTACTATGATT
AATTATATTCACAGAGTCGGACGTACTGGAAGAGCTGGAAGAACAGGCAGAGCAATTACC
TTCTTTACAAACGAAGATAAGCCTTTGCTTAGAAGTTTAGGAAATATGCTTAAAGTTTCA
GGATGTGATGTACCTGAATGGATTTTCAAATTGCAAAAGGCTGATAAGAAAACTTTAAAA
AGACTCGAAAAGTTCCCAGTAAAAAGAGATGCTATTTCCTTAGATCCATCTAAATAAAAA
GAAAAAGATTTAGAATTCGAAAAGCAAATTAGAATAGCTGATGGACAATATTTTAGTAGA
AAGAAAAAAATAGATAGAGAAGAAAGAAGAAAATAATAACAAAACTAAGGAAAGGAAAAC
GAAGACGATGGCTGGTAGATAGCATGA


>TTHERM_00700870(protein)
MKQQQSIKKVSGTQQAQKDSKKKLNFFQILKTGTSFYQKEENNRFQKQTEKVNQAVRESS
QPKRKLSDNNLAQKYNENDSDDSDNENLKQLNEQITQTKSRRKMSIDELEKDWEHQQQLK
QAKIKALMKLYKVKVEGDNIPPLLTNFTKMQKKYGFNQKILDNMKKAGYEKPTPIQMQSV
PIIMEKRNLLALAPTGSGKTAAYCLPLLQKLGTHQKNGVRALIFAPSNELAEQILREFEF
LNYGVEDGLRIKQIQKINNESNAFKIQLEHIDILITTPLKFIKMNRKSHTEFDKLEYIVF
DEADRYFEFNIAGQMKRILETFQEKQGLTYLLFSATIQHPVEELVKNIIVDPLKLQIGGK
NNVLASIEQSLSYCQSEYGKLVELKNIINNGEFNPPVLIFVQSKERGEELLSMIKSSCVN
TPIKIEKIDSDKQKEEREEVIEDFRTGKLWALICTDLMARGIDFKGVNLVINYDFPTTMI
NYIHRVGRTGRAGRTGRAITFFTNEDKPLLRSLGNMLKVSGCDVPEWIFKLQKADKKTLK
RLEKFPVKRDAISLDPSKQKEKDLEFEKQIRIADGQYFSRKKKIDREERRKQQQNQGKEN
EDDGWQIA


>TTHERM_00700870(gene)
ATGAAATAGTAGCAATCAATCAAAAAAGTTTCAGGAACTTAGCAAGCATAAAAGGATTCT
AAAAAGAAGTTAAACTTCTTTTAGATTTTGAAGACAGGCACATCATTTTACTAGAAGGAA
GAAAATAATAGATTTTAAAAAGTAGCATTACATTCAGCTTTAATTAATTGATTCCTTCAT
TCATTTTTATGATATAAACATAATTTTCTTACTTTATTAGCAAACAGAAAAAGTAAATTA
GGCCGTTAGAGAATCTTCTTAACCCAAGAGAAAACTTTCTGACAATAACCTAGCATAAAA
ATATAATGAAAACGATAGTGATGATAGCGATAATGAAAATCTTAAGCAATTAAATGAACA
AATCACTTAAACAAAATCTCGTAGAAAAATGAGCATAGATGAATTAGAAAAGGATTGGGA
ACATCAGTAGCAACTTAAGCAAGCTAAAATCAAAGCATTGATGAAATTGTACAAAGTTAA
AGTTGAAGGTGATAATATTCCACCTCTCTTAACTAATTTCACTAAAATGCAAAAGTAAAC
AAATAATCTTTTTATGTTTATTAGCTTCTTCATATTTAATATATTCTTTGGGTTATTTCT
ACTAACAAGATATAGATTTTTAAGACAAATATATATATAGTTTATTATTTTCACTATTAA
ATGAGCAAAAATATTACTAAATAAAGTAATAAACAAGAATCTAAAATACCATTTATCAAA
TAGGAAGTATGGATTTAACCAAAAAATATTGGATAACATGAAGAAAGCTGGTTATGAAAA
GCCTACTCCAATTTAGATGTAATCAGTACCAATAATTATGGAAGTAAAATTATATAATTA
AATTATTAAGTAAATAAATCAATGAATATCTATCTCTTTTATCTAAAAGAAAAGAAATTT
ACTAGCACTTGCTCCTACTGGAAGTGGTAAAACAGCTGCTTATTGTCTTCCATTGCTCTA
GAAACTAGGCACTCATTAAAAAAATGGAGTCAGAGCTCTCATTTTTGCTCCCTCAAACGA
ATTGGCAGAGTAAATTTTAAGAGAATTCGAATTCTTAAATTACGGAGTTGAAGATGGTCT
CAGAATCAAATAAATTTAAAAAATAAATAATGAATCAAACGCTTTCAAAATATAACTTGA
ACATATCGATATTTTAATTACTACTCCATTAAAGTTCATTAAAATGAATAGAAAATCTCA
TACAGAATTTGATAAGTTAGAATACATTGTATTCGATGAAGCAGATAGATACTTTGAATT
TGTAAGTGAATTTATCAAAAATATCAAATTAATTTATTTATTTTATTTTGAATAGAACAT
TGCTGGTTAAATGAAGAGAATTTTAGAAACATTTTAAGAAAAGTAAGGGCTAACTTATTT
ATTATTTAGTGCAACTATTCAACATCCTGTAGAAGAATTAGTTAAAAATATTATCGTTGA
TCCATTGAAATTGTAGATTGGAGGTAAAAATAATGTTTTGGCTTCAATTGAGTAGTCACT
TTCTTACTGCTAAAGTGAATATGGCAAACTTGTCGAATTAAAAAATATTATTAACAATGG
TGAATTTAATCCACCTGTCCTTATTTTTGTTCAATCTAAAGAAAGAGGAGAGGAATTACT
TTCTATGATAAAAAGCTCCTGTGTGAATACACCTATTAAAATAGAAAAGATTGATTCTGT
AAATAAATAATTAAATAAATTAATTTTCATTTTTTATCAAAGCAAAAATTGTATTTTTTA
ATTATTTAGTGATAAAGATATTTAAAAATAAAAATTATTTTAGAAACAAAAGATTTTATT
AAACAAAAATAAAATAAAAGCTGGTTGAGCAATAAATATTTTTACTTTATTTTTGCGAAG
TGAAATTAAATAAATTATTATTCAAAAATATATTTTGTGAAAGATGTTAAATTTTTAATT
TAATAAAAATAATAGGATAAGTAGAAAGAAGAAAGAGAAGAAGTTATTGAAGATTTTAGA
ACTGGTAAGTTGTGGGCTTTAATTTGTACAGATTTGATGGCAAGAGGTATTGACTTTAAG
GGAGTTAATTTGGTCATTAATTATGATTTTCCAACTACTATGATTAATTATATTCACAGA
GTCGGACGTACTGGAAGAGCTGGAAGAACAGGCAGAGCAATTACCTTCTTTACAAACGAA
GATAAGCCTTTGCTTAGAAGTTTAGGAAATATGCTTAAAGTTTCAGGGTAAATTTTAAAT
TTTACAACAAAAAAATTATTTATTTATTCATTCAATAAAAATAAATAGATGTGATGTACC
TGAATGGATTTTCAAATTGCAAAAGGCTGATAAGAAAACTTTAAAAAGACTCGAAAAGTT
CCCAGTAAAAAGAGATGCTATTTCCTTAGATCCATCTAAATAAAAAGAAAAAGATTTAGA
ATTCGAAAAGCAAATTAGAATAGCTGATGGACAATATTTTAGTAGAAAGAAAAAAATAGA
TAGAGAAGAAAGAAGAAAATAATAACAAAACTAAGGAAAGGAAAACGAAGACGATGGCTG
GTAGATAGCATGA