Identifiers and Description

Gene Model Identifier

TTHERM_00449630

Standard Name

DRH35 (DExD/H box RNA helicase 35)

Aliases

PreTt15476 | 52.m00254 | 3811.m01008

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • folic acid-containing compound biosynthetic process (IEA) | GO:0009396

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00449630

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15014.19.997093137033517e-262type III restriction enzyme, r
es subunit protein (884 aa)
OxytrichaContig7520.0.g661.999382702437002e-145DEAD/DEAH box helicase
DictyBaseDDB_G02929925.001897638882051e-133helA on chromosome: 6 position
2367392 to 2370667
WormBaseWBGene000223786.001241942754875e-123status:Confirmed UniProt:Q68
8Z3 protein_id:CCD74205.1
SGDYDL031W2.99975439004962e-112DBP10 Putative ATP-dependent R
NA helicase of the DEAD-box pr
otein family, constituent of 6
6S pre-ribosomal particles; es
sential protein involved in ri
bosome biogenesis
Stentor CoeruleusSteCoe_294875.166420632837861e-55

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00449630(coding)
ATGGGTAAAGATTTTAATAAAAAGCAAAAATTTGTCAAATAAGACAAGGAAATTAACGTT
ATTGAAGATGAAGAAAAGAAATCTAAGAAGAAGAAAGGAGGTGGTTTTGAATCTATGAAT
TTGGTCTATCCTGTTTATAAAGCTATCAAAACTAGAGGTTTTAATATGCCTACTCCTATT
TAAAGAAAGGCTATTCCTCTTATTCTTGAAGGAAGGGATGTTGTTGCTTGTTCTAGAACT
GGTTCTGGTAAAACTGCTGCCTTTATTATTCCATTAATCAATAAATTACAAAATCACTCT
AGAATTGTTGGTGCCAGAGCTTTGATTGTCGTTCCTACTAGAGAATTGGCTTTACAAATT
GCATCCGTATTGAAAACATTTATTAAATTCACTGACTTGACCTATACTTTGATTGTTGGT
GGTCACGGCTTGGAAGGATAGTTCGAAAGTTTAGCATCTAACCCAGATATTATTATTGCT
ACTCCTGGTAGACTTAGTTAGTTGATAGATGAAACTGATTTGTCTTTGAATAAAGTAGAG
TTCTTAATTTTTGATGAGTGTGATTATTTGTTTGAAATGGGTTTCGCTGATTAAATGAAG
ACTATCTTAAAAAAAGTAAGCCAATAAAGATAAACGCTTATGTTTTCTGCTACCATTCCA
GAGGAATTGTCATCTTTTGCAAGAGCTGGTTTGAAAGAATACGTCTTTGTTAAGTTGGAT
TCAGAATTTACAATTAATGAAAATATTACTCTCAATTTCATCCTCACTCGTAATAATGAG
AAAATAGCTTCTCTCGTTTATTTACTCAAAAGTGTTATTCCTTCAGAAGAAAATAGCATT
GTTTTTGCAAGTACTAAATATCACGTTGATTTGATTTGTGCTATTTTGGATAAATTCAAC
ATCAGCAATGTTTCTATTTATGGTAAAATGGATGCTTTTGCTAGAAAAGATTAAATCAGT
GAATTCAGAAATAAAAAGTGTAATGTCATGGTAGTTACAGATTTAGCAAGTAGAGGTATT
GATTTACCTAATGTAAATAATGTTATTCATTACGATTATCCCGCATCTACCAAAATTTTC
ATCCACAGATCTGGTAGAACTGCTAGAGCTGGTCGTAAAGGTAACACTTATGCCTTAATG
GGTATGAATGAAATCATGTATGTCTCCGAAATTATGGTTTTAGCTGGAAGAAAGTTAAGC
AATCAAGTTGAAGATATGAAAGACACTTCTAAAGCTATTTATGGTGCCATTCCCGTTTAA
CTCATCGGTGATGAACAAGCAAAAATCTAAATTCTATTAAAAGAAGATATTGAAATCAAC
AAAATGTAGCAATTAGCCAATAACGCCTACATTCAATTTAATAAATCTCGTTCTAGTGCA
AGCAAAGCTTCAATCAAAGACTCTTATTAAGTTAAAATAGATTCAATTAACCCTCTTTTC
CACAAGTTCGCTGAAGATGAAAAGGAAAAAATGGATTACTTATCTAAAATTAAAAATTAC
AAGCCAGCAATAAGTGCTTTGGAAATTTACAAGCAAAGAAGTTTAAAGAATCATACTGGT
ACTGAAGATCCCAGCTTGCTTGAAAATGTCAATACACTTGCTAAATCAGTAGCTGATTTA
AAGAAGCAAAAATAAATGTTCAAAGACAAGTAAGAGAGAATAGAGAAAATCAACAAAATT
AAGATGGGTATTGCCCTCCAAAACGATGGTGAAAAAATGGAAATTGAAAACAACAAAAAA
GCTGCTGCTGAAGAAGAAGAGTATGTAGATGAAGGCTTATTAGATGAAGAACTTGTAAAG
AAAATGAATGAAGCCGAATAAGAGTTTGAAGAAGATGAAGATGATGAAAAACTTATTAAT
GACGAACCTGAAATTAAATAAAAGGAAGATACATAAGAATAATATATTATAGATCACAAG
CCTAAAAAGATTAAAAAGTCTCAAATGGTAGATTTCAAGAACAAAGACCAATACATTGAA
GCTTAACCTGATTATCACAAACCTAAAAAGAGTATTGAAGATGAAAATAAAATCTCCTCT
ACTGATGTTAATGCCTTTGTTGTTGCAGAAGATTACGAAGATCTTCTCAGAAATAAAAAG
AAAATGATTTGGGATAAGAAAAAGAAATAGTTTGTTTTCGGTAAGACTGATGAAGTAGGT
AGAGTTGTAAGAGACAAAGAAGATAAAAATAAAAATGGTAAGAAAGGTAAAGTTGCTAAG
GAAATGCTTAAAAAATGGGAGAAGAAGAACTAGATCAAGTTGTAAAGAGATGGTGAGTAA
GAAGATACAACTCTTGTTGATAGAGTCAGAGGTATGTTCAAAAAGAGAGCCCTCAGATAG
AAAGGTATTTACTTACCCGAAGACAACCTAGAAAAATAATAAAAGGGTGTTAAGAGCGAA
TTAAAAAGCCATCAACAAATACTTAAATAAAAAAAAATAAAGAAGGGTCTTAAATTCAAA
AACATGGAAAAAGGTAAAAGAACCCAAATTATTCATAAGAAAAAGTAAGCCTCAGCAAAG
ATGGCCGATAAGAAGGGAGGATTTGGTAAACCAAAAGGAGGTTTTAGCAAACCTAAAGGT
GGAAAATTCAGAAGATGA


>TTHERM_00449630(protein)
MGKDFNKKQKFVKQDKEINVIEDEEKKSKKKKGGGFESMNLVYPVYKAIKTRGFNMPTPI
QRKAIPLILEGRDVVACSRTGSGKTAAFIIPLINKLQNHSRIVGARALIVVPTRELALQI
ASVLKTFIKFTDLTYTLIVGGHGLEGQFESLASNPDIIIATPGRLSQLIDETDLSLNKVE
FLIFDECDYLFEMGFADQMKTILKKVSQQRQTLMFSATIPEELSSFARAGLKEYVFVKLD
SEFTINENITLNFILTRNNEKIASLVYLLKSVIPSEENSIVFASTKYHVDLICAILDKFN
ISNVSIYGKMDAFARKDQISEFRNKKCNVMVVTDLASRGIDLPNVNNVIHYDYPASTKIF
IHRSGRTARAGRKGNTYALMGMNEIMYVSEIMVLAGRKLSNQVEDMKDTSKAIYGAIPVQ
LIGDEQAKIQILLKEDIEINKMQQLANNAYIQFNKSRSSASKASIKDSYQVKIDSINPLF
HKFAEDEKEKMDYLSKIKNYKPAISALEIYKQRSLKNHTGTEDPSLLENVNTLAKSVADL
KKQKQMFKDKQERIEKINKIKMGIALQNDGEKMEIENNKKAAAEEEEYVDEGLLDEELVK
KMNEAEQEFEEDEDDEKLINDEPEIKQKEDTQEQYIIDHKPKKIKKSQMVDFKNKDQYIE
AQPDYHKPKKSIEDENKISSTDVNAFVVAEDYEDLLRNKKKMIWDKKKKQFVFGKTDEVG
RVVRDKEDKNKNGKKGKVAKEMLKKWEKKNQIKLQRDGEQEDTTLVDRVRGMFKKRALRQ
KGIYLPEDNLEKQQKGVKSELKSHQQILKQKKIKKGLKFKNMEKGKRTQIIHKKKQASAK
MADKKGGFGKPKGGFSKPKGGKFRR


>TTHERM_00449630(gene)
ATGGGTAAAGATTTTAATAAAAAGCAAAAATTTGTCAAATAAGACAAGGAAATTAACGTT
ATTGAAGATGAAGAAAAGAAATCTAAGAAGAAGAAAGGAGGTGGTTTTGAATCTATGAAT
TTGGTCTATCCTGTTTATAAAGCTATCAAAACTAGAGGTTTTAATATGCCTACTCCTATT
TAAAGAAAGGCTATTCCTCTTATTCTTGAAGGAAGGGATGTTGTTGCTTGTTCTAGAACT
GGTTCTGGTAAAACTGCTGCCTTTATTATTCCATTAATCAATAAATTACAAAATCACTCT
AGAATTGTTGGTGCCAGAGCTTTGATTGTCGTTCCTACTAGAGAATTGGCTTTACAAGTA
ATATCATTTAGATTTTTTACACAAAAAGCATTTTAGCATAAAATGAATGAATTTTTTACA
AAATCTTTGCTTTATATTTGAATATTGTATTCATTTGACATTTAAATTAAATATTTTATA
TAAATATAGATTGCATCCGTATTGAAAACATTTATTAAATTCACTGACTTGACCTATACT
TTGATTGTTGGTGGTCACGGCTTGGAAGGATAGTTCGAAAGTTTAGCATCTAACCCAGAT
ATTATTATTGCTACTCCTGGTAGACTTAGTTAGTTGATAGTAAATTGCATACATTTTATC
ATCAATATTAAGATTATTTAATATAATTATTTAGGATGAAACTGATTTGTCTTTGAATAA
AGTAGAGTTCTTAATTTTTGATGAGTGTGATTATTTGTTTGAAATGGGTTTCGCTGATTA
AATGAAGGTAAAATATTAAATAAAATGTTAGCACTCTTTTAAAAATACCATGTATAAAAT
AGACTATCTTAAAAAAAGTAAGCCAATAAAGATAAACGCTTATGTTTTCTGCTACCATTC
CAGAGGAATTGTCATCTTTTGCAAGAGCTGGTTTGAAAGAATACGTCTTTGTTAAGTTGG
ATTCAGAATTTACAATTAATGAAAATATTACTCTCAATTTCATCCTCACTCGTAATAATG
AGAAAATAGCTTCTCTCGTTTATTTACTCAAAAGTGTTATTCCTTCAGAAGAAAATAGCA
TTGTTTTTGCAAGTACTAAATATCACGTTGATTTGATTTGTGCTATTTTGGATAAATTCA
ACATCAGCAATGTTTCTATTTATGGTAAAATGGATGCTTTTGCTAGAAAAGATTAAATCA
GTGAATTCAGAAATAAAAAGTGTAATGTCATGGTAGTTACAGATTTAGCAAGTAGAGGTA
TTGATTTACCTAATGTAAATAATGTTATTCATTACGATTATCCCGCATCTACCAAAATTT
TCATCCACAGATCTGGTAGAACTGCTAGAGCTGGTCGTAAAGGTAACACTTATGCCTTAA
TGGGTATGAATGAAATCATGTATGTCTCCGAAATTATGGTTTTAGCTGGAAGGTAAAAAA
TATTTTTAAATAAAATTGTAAAATAAGTTTTCTAAAATAAATTTTTATAAAATTTCAGAA
AGTTAAGCAATCAAGTTGAAGATATGAAAGACACTTCTAAAGCTATTTATGGTGCCATTC
CCGTTTAACTCATCGGTGATGAACAAGCAAAAATCTAAATTCTATTAAAAGAAGATATTG
AAATCAACAAAATGTAGCAATTAGCCAATAACGCCTACATTCAATTTAATAAATCTCGTT
CTAGTGCAAGCAAAGCTTCAATCAAAGACTCTTATTAAGTAATTAAATAAATTTTATCTT
TGAAGATGTACTTAAATATAATGCATAAAAATAGGTTAAAATAGATTCAATTAACCCTCT
TTTCCACAAGTTCGCTGAAGATGAAAAGGAAAAAATGGATTACTTATCTAAAATTAAAAA
TTACAAGCCAGCAATAAGTGCTTTGGAAATTTACAAGCAAAGAAGTTTAAAGAATCATAC
TGGTACTGAAGATCCCAGCTTGCTTGAAAATGTCAATACACTTGCTAAATCAGTAGCTGA
TTTAAAGAAGCAAAAATAAATGTTCAAAGACAAGTAAGAGAGAATAGAGAAAATCAACAA
AATTAAGATGGGTATTGCCCTCCAAAACGATGGTGAAAAAATGGAAATTGAAAACAACAA
AAAAGCTGCTGCTGAAGAAGAAGAGTATGTAGATGAAGGCTTATTAGATGAAGAACTTGT
AAAGAAAATGAATGAAGCCGAATAAGAGTTTGAAGAAGATGAAGATGATGAAAAACTTAT
TAATGACGAACCTGAAATTAAATAAAAGGAAGATACATAAGAATAATATATTATAGATCA
CAAGCCTAAAAAGATTAAAAAGTCTCAAATGGTAGATTTCAAGAACAAAGACCAATACAT
TGAAGCTTAACCTGATTATCACAAACCTAAAAAGAGTATTGAAGATGAAAATAAAATCTC
CTCTACTGATGTTAATGCCTTTGTTGTTGCAGAAGATTACGAAGATCTTCTCAGAAATAA
AAAGAAAATGATTTGGGATAAGAAAAAGAAATAGTTTGTTTTCGGTAAGACTGATGAAGT
AGGTAGAGTTGTAAGAGACAAAGAAGATAAAAATAAAAATGGTAAGAAAGGTAAAGTTGC
TAAGGAAATGCTTAAAAAATGGGAGAAGAAGAACTAGATCAAGTTGTAAAGAGATGGTGA
GTAAGAAGATACAACTCTTGTTGATAGAGTCAGAGGTATGTTCAAAAAGAGAGCCCTCAG
ATAGAAAGGTATTTACTTACCCGAAGACAACCTAGAAAAATAATAAAAGGGTGTTAAGAG
CGAATTAAAAAGCCATCAACAAATACTTAAAGTAAATATATTTAAAAAAAAGGTTATTCA
TTATAATTAATTCATTCATTTTTTATAAAATAGTAAAAAAAAATAAAGAAGGGTCTTAAA
TTCAAAAACATGGAAAAAGGTAAAAGAACCCAAATTATTCATAAGAAAAAGTAAGCCTCA
GCAAAGATGGCCGATAAGAAGGGAGGATTTGGTAAACCAAAAGGAGGTTTTAGCAAACCT
AAAGGTGGAAAATTCAGAAGATGA