Identifiers and Description

Gene Model Identifier

TTHERM_00302060

Standard Name

DRH34 (DExD/H box RNA helicase 34)

Aliases

PreTt19398 | 28.m00357 | 3691.m00174

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF02889 ) Sec63 domain
  • ( PF00580 ) UvrD/REP helicase
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR01257 ) rim ABC transporter
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF05707 ) zonula occludens toxin (Zot)
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00302060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_31550
WormBaseWBGene000128969.997093137033517e-262locus:snrp-200 Putative U5 s
mall nuclear ribonucleoprotein
200 kDa helicase status:Par
tially_confirmed UniProt:Q9U
2G0 protein_id:CAB60351.1
Tetrahymena borealisEI9_07732.19.997093137033517e-262type III restriction enzyme, r
es subunit protein (2209 aa)
DictyBaseDDB_G02700429.997093137033517e-262ascc3l on chromosome: 1 positi
on 4082408 to 4089294
OxytrichaContig18508.0.g439.997093137033517e-262Sec63 Brl domain
SGDYER172C9.997093137033517e-262BRR2 RNA-dependent ATPase RNA
helicase (DEIH box); required
for disruption of U4/U6 base-p
airing in native snRNPs to act
ivate the spliceosome for cata
lysis; homologous to human U5-
200kD

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00302060(coding)
ATGGCCGATTAGCGTTAGGTTATTGATCAATTCAACACACAAGCAAATGAAGTTATTTAA
GGAGAAAGATAAAGAGGAGATGAGAATACTGGTGAGCCTATTTCATTAGTAGGTCATTTA
GATTCATTGAAGATGGGTGAATATGCTGTCAGATAAAATCCTAAAAAGATTTTAGATATG
ATGAAAAAGAATGAAGACTCAAAGCTCAAAAAAAAGAAAGCAGACAATTTAGTTTAACCT
AAAAAGAAAACTAAAATAAAAATTGAAAAGAAAGATATTTTGAATGCTGAAATTGACCCT
TCAATTTTATATAAGCCTAAAACTAACGAAAACAGGATATTGTACGAGAGTATCTTAAGC
AAAGTTAACAAAATTTTAACAGATTAGCCAAGAGATGTTCTCATAAGTGTAACAGATAAT
ATTCTTGCTACCTTGAAAAATGATAATTAGAGAGATAAGGAGAAAAAAAAAGAAATTGAT
TAGCTTATCTAGACTGAAATTCCTTAAGAAATATTTGATTCCTTATTAACTACTGCAATG
CAAATCAATGATTACAATTAATCTTATGAATAAAATGAATAAAAGTATGGCAATGATGAA
GATCAAGATATGGGTATTGATGAAGAAGATGATGAAGATGATAATGATGATGATTAAATC
TAAGCTTAAGTTTAAGATTAGCAAGATATTGATGAAGAAAGTGACTAAGAAGATGAAGAT
TAGGAATAAAATTAATAGATTAAAGCTCTTAATGGAGACAACTTTAGCAATCAAAATGAA
AAGAATGATCCTAACAATATTGATGTTAGAGCTATTGATGCATATTGGCTTTAAACCAAA
TTAAATGATATTTATAACGACCCCATGTAAGCTTAGAAAAAAGATAAAGAAATATTGTCT
GTGCTTAATGAACAAAATAATATTATTTGTCAAAGTCAATTAATTAAGATATTAGGTTAT
GATTAGTTTGATTTAATTTCTTTGCTTGAAAAAAATAGACACAAAATTTACTTTTGCACT
TTGCTTTAGAGAGCTGAAAAGTAATAGGAAAAAGATTAAATCATTGAGTAAATGAGATCA
ACAGAAGCAGGAGAAAGAGTATGGGAATAATTACAAAATATTGATAAAAAATATAAATCA
GATCATTTAAATAAATTTGACTCTAAGAGCAAGATGGCTAATCTTAAGGGTAAAGAAATG
GATATTGAAGAGCTTATTACTGCAAACAAGATTACAGATGAAGAATTCAATAAAATCAGT
AAGAAAATACTTGACTTAGAAAGTTTAGTTTTCTAAGAAGGTTCTCACTTCATGAGCACT
TAGCAATTCACTGCTCCAGAAAGAGCCACTAATTGTTCTTATAAAGGATACGAAGAGACA
ATTATAAATGCAACTTAAATCAAAATAAACGCAGAATTAAAATAAGTTACAGCATTACCT
GAATGGGCCCAAAAGCCTTTCGTAGATAAAGAAGTTAATATAAAAGAATTCAATCCAATT
TAATCAGCCGTGTTTGATTGTGCTTTTAACAGAACTGAAAATATGCTGGTTTGTGCACCT
ACTGGAGCTGGTAAAACAAATATTGCCTTGCTTGCGATTCTTAACGTCATAGGCAAATAT
ATTGACCGTAGAGGAGTTGTGAATTTAAACAAATTTAAAATTGTTTATTTGGCACCAATG
AAAGCCTTGGTTGGTGAAATGGTTTTAACATTCACATAGAGACTTAAATATTACGGCATT
ACTGTAAGAGAACTTACAGGTGATAGTTAATTGTCTAAAGAACAAATCGATTCAACTTAA
TTGATTATCGCTACACCTGAAAAATGGGATATTATCACTAGAAAGGCAGGAGACAGAACT
TATACAGAGCTTGTTAGACTTTTGATTATTGATGAAATTCATTTATTGCATGATTAAAGA
GGTCCAGTCCTTGAAGCTTTAGTTGCAAGAACTATAAGAATGACTGAATAGACCTAGGAA
AATGTTAGAATAGTTGGTTTATCTGCAACTCTTCCAAATTTTGCTGATGTTTAGAATTTC
TTGAGAGTAAAGCCTTTGAATAAAAAAGAAAATACTGGTGGTATGTTCTTTTTTGATCAT
ACCTATCGTCCTGTCCCTCTTTAACAATCATTTATTGGTATTTCTGAAAAGAAGGCAGCT
AAAAGAATGCTTTTAACAAATGAAATCTTGTACTAGAAAGTTGAGTAAAGAGCTTCTAAG
GATCAACCTTTATTCATTTTTGTTCACTCAAGAAGGGATACTGTTAAAACTGCAAATTTT
TTACGTCAATAGGCTTACCAAATGAACGAATTAAATAAATTTGTAGAAGAAGGGTCAAAT
GCAGAAGAAATTTTAAAGAAAGCTGCTGAAAATATCTAAAATAAAGATTTGAAGGAAATG
ATTGTCTAGGGATTTGCAGTCCATCATGCTGGTTTAAGTAGAGATGATAGGGATATTGTA
GAAAATTTATTCTTCTAAAATCGTTATTAAAAGACAATTAAAGTTTTAGTTTGCACAGCC
ACTTTAGCTTGGGGTGTTAATATGCCTGCTTCTTGTGTTATCATAAAAGGTACTTAAGTT
TATTCTCCTGAACTTGGTAAATGGACTGAATTGAGCCCTCAAGATATGATCTAGATGGTT
GGTAGAGCTGGTAGACCTGGCTTTGATCTAAGGGGAGAAAGTATTGTTATTACCTCTTTT
TAGGAAAAAAATTACTATTTGAGTTTACTTAATCAATAACTACCTATTGAATCCTAATTC
ATTAGTTAACTCCCTGATTAATTGAACGCTGAAATTGTATTAGGAACAGTGTCTAACATT
AAAGAAGCTGTTGATTGGCTTGGTTATACATATTTATATATTAGAATGTTGAGAAGCCCT
AAGGTTTATCATATTTCAGATGAAGAATATGAAAATGATAGACTCCTAGTAAAGCATAGA
GCTAATTTGATTCATTCAGCAGCTACTTTACTGGATAAATATGGACTTATAAAATACGAT
AAGAAAACCGGTATTTTCTAATCGACTTCATTAGGTAAGATTTCATCTCACTATTATATC
AAATACCCTTCGATGGAAATCTATAATAAGCACTTAAAGCAAAATATGGGTGTTATTGAG
TTACTTAAGGTTTTCTCTCTTTCTAATGAATTTAAATACATTCCTATTAGAGAAGAAGAA
AAAGCTGAACTCTCTCGTCTCATGGAAAGTGTACCTATACCTGTTAAGGGTTCTATAGAA
GAACCTTCTTCTAAAATAAATGTTCTTTTATAGGCTTACATTGGTAAATTACCTATGGAA
GGATATGCATTGAATGCTGATATGATTTTTGTTACATAAAGTGCTGGACGTATTATGAGA
GCTATATTTGAGATTTCATTAAAGAGAGGATGGGCTTATGTTGCTGAAAATGCATTAAAT
CTTTGTAAAATGATTGATAAGTAAATGTGGAGCTGCATGACACCTATCAGATAGTTTAGA
TAATCAAGCAATAAGAAATTCGGTAAAATTGGTGAATCTATTTTCAGAAAAATAGAAAAA
ATAGAATAAATGACATTTAATCGTCTAAAAGCCATGAATGAATAATAATTAATGGAACTT
TTGAAAACAGGTGATACTAAAAATAATAAGCTTGGTGCCATTCTTAAAAATAGAATTCGT
ATGATGCCAGAACTTAAAATAACTGTAGATAAGATTCCTATCACAAGAAGTTGTTTACAA
GTTACTATTACTATCGATAAAGGAGATTTCTAGTGGGAAGACTCTTTCCATGGTGATTCA
GAGCCATTTTGGATATTGGTAACTGACTGTGATGAAGAGGAATTACTTTACCATGAATAT
TTCACTGCAAAGAAGCACAAATTATGTGCAAAAAGATCCGAAGACGAACAAAGTCCCTAC
GTTTTCTAATTTATTGTAAGTCTATTTGAAAACTTGCATCCTGTATACTATATCAAAGTT
ATTTCTGACAGATGGATTTAGTGTGAGACTATTGAACCTCTTTTCTTTAAAGATTTAATC
CTCCCTGAGTAATTCAGTGCTCCTACTAAATTGTTAGAATTCTAGTTAGTACCCACATCA
GAATTAAGATTCCCTGAAGGAGAGGCTGTTCTAAAAGAATTAGGAATTACTACCTTCAAC
AAAATATAAACATAAGTTTTGAATCAATTTTACAGTCAATCTGAAAATATATTCCTTGGA
GCTCCTACTGGCTCAGGAAAAACAGCTTGCATTATTGTTGCTATGCTAAGAATTTTTAAA
ACATACTATGAAAATAAAAAAGTAATTTATGTGGCACCTTTTGAATCTATTTGCCAAAAT
ATGTACAAACTATTTTCTAAGGCTTTTAAGCATCTTGGCAAAAAGGTTGCCATATTGACT
GGTTAAACTAAAACAGACAACCAAATTTTTACCAAGTATGATATTATTATATCTACACCT
GAAAACTGGGATATAAACACTAGAAAATGGAAAAAAACACAATAAATCATTAACAAAAAT
ATAAAACTTTTCATTGCTGACGAACTCCATATGCTTAATGAATGTAATTCAACTTATGAA
GTTATTGTTTCTCGTATGAGATAGTTCTCTTCATTGCTTTCTTCTAAATCAGAAGGCAAA
TAAGAAGGCAAGAAAGAAGTTAATCATAATTTTCAAATTATTGGTTTGGCTACTTCTGTA
GCTGACTATAAAGAAATGGCATCATGGATTGGTGCTAATCCTAGCAATACCTTTAATTTC
AGTCCTGATGTTAGACCTTACCCTGTAGATTTACATATTACTGGTTTTGAATAGCATCAC
AGAAAGGCTCGTTTAATTTCTATGCAAAAGCACATGTATTAAGGTCTCAAATTATTCTTA
AAATCACCTCAATAGTAAGGCATAATTTTTGTTTCTGATAGAAAGTAAGCTAAAATCACT
GCTATTGATTTGTAAACTTTAGCCGCAGGTGACAATAATCCTTAGAAATTCTTGAAGGTT
CCATATGATAGTATTTAAGAAATAGTCGAGTCATTAAGAGATCTCTCTTTGAGATAATCA
TTAAAATATGGTGTCGGATTTATCTATGAAGGTATGAGTGAATAGGAAAGAGAAGTTGTT
GAGTCACTATACTAATCTGGAGCTATTTAAGTTCTAATCTCAACATACAAATTATGCTGG
GAGCTCAATCTTCACTCTTAAGTTGTTATCATCCTTGACAATCAAAGATATGATGGTCGT
GAAAAGAGATATATTGATTATACCATTCCTGATATGCTTTAAATGATAGCTTATGCTAAG
AGTAAAAACGCAAGTGCACAAAACGCTTAAGCAGCTAAGTGTTTAGTCTTTTGCCATTCT
CCAAAGAAAGAATATTATAAGAAATTCTTATTTGAACCTTTCCCTGTAGAATCAATCTTA
TCAGAAAACATAACTAATCACATTTGTGGTGAAATTTATGCTGAAAGAATTACTTCTTTA
CCAGCTTGTATTGACTGGAGCACTTGGACATTTATGTATAGAAGATTATCTTAAAATCCT
TACTTCTATGGACTCAGAGAAGTTTCAGGACCTGCCATTAATGATTTCTTGTGTGATCTA
TTTGAAAAAGCTATTGAATATTTAATAGAATATAAGTGTGTTAAAGAATTAGAATAGCAC
AATTTAGCTCTTTTAAGTTTAGGTTCTATTGCAGGATATTACTATATTGATGTATAAACA
ATATAAATGTTTAATGAGAGAATAAAGCCAGACTAATCAACAAAGCATTTGATTAACATC
ATCTGCTCTGCAAATGAATTCTTGGATATCCCTGTTCGTCACTAAGAAGAAAACCTATTA
AAGTAATTGAATCAATAAATTATGTATCCTGTAGATAGTAGCATTGAAGTTTTCAATGAT
CCAAATGTGAAAGCATATATTTTACTTTAAGCTTATTTCTCACGCTTGAACCTTTCTGCA
GATTTCTCTTATGACTAAAAGCTAGTTTTAGACAAGGCAGTTAACTTAACACACGGATTA
ATTGAAGTTATAAACTCAAATGGCTTACCAAAAGAGGCTATAAAAGCAATGAGATTCTCT
CATATGATAGTGCAAGCAGTCTGGACTGATAGCTCTCCACTTTTATAACTTCCTCACTTT
AACGAGAAAATAGTTAAAGCTCTAGCAGATCTTGATGTCAAATCAATTAATGATCTTCTT
AATAATGATGAAGCTAGAGATTAAGTTTTCGAATAGTTTAAATTCTCTGAATCAGAAATC
GAAGAAATTGCTAATGCAGCAAACAGATATCCTGATATTAACTTTACATATAGCATTTAG
AATGTAAATAGCATTTATGAAGGAGATGATAAGGTTAATATGAAAATATCAATCACAAGA
GAAGGTGAAGATTATACTGATTTTGTTGTTGCACCTTACTATCCCAAGTAAAAAGAAGAA
TTGTGGTGGGTAATGGTTGCAGATACCAATAAAAATATACTTCGTTGCATAAAAAAGCTT
GGTTTTAAGTAAAAGGCAGATGTTGACTTCTAATTTGATGTACCTGAAGCTGGTTCTCAT
GAACTAAGAATAATTTTAATGTGTGATTCTTATCTTGGCTGTGATACAGGAAAACAATTC
ACTTTGAATGTAAAACGTAGAGGTGCTAATGGAAGTATGGAAGACGAGTGA


>TTHERM_00302060(protein)
MADQRQVIDQFNTQANEVIQGERQRGDENTGEPISLVGHLDSLKMGEYAVRQNPKKILDM
MKKNEDSKLKKKKADNLVQPKKKTKIKIEKKDILNAEIDPSILYKPKTNENRILYESILS
KVNKILTDQPRDVLISVTDNILATLKNDNQRDKEKKKEIDQLIQTEIPQEIFDSLLTTAM
QINDYNQSYEQNEQKYGNDEDQDMGIDEEDDEDDNDDDQIQAQVQDQQDIDEESDQEDED
QEQNQQIKALNGDNFSNQNEKNDPNNIDVRAIDAYWLQTKLNDIYNDPMQAQKKDKEILS
VLNEQNNIICQSQLIKILGYDQFDLISLLEKNRHKIYFCTLLQRAEKQQEKDQIIEQMRS
TEAGERVWEQLQNIDKKYKSDHLNKFDSKSKMANLKGKEMDIEELITANKITDEEFNKIS
KKILDLESLVFQEGSHFMSTQQFTAPERATNCSYKGYEETIINATQIKINAELKQVTALP
EWAQKPFVDKEVNIKEFNPIQSAVFDCAFNRTENMLVCAPTGAGKTNIALLAILNVIGKY
IDRRGVVNLNKFKIVYLAPMKALVGEMVLTFTQRLKYYGITVRELTGDSQLSKEQIDSTQ
LIIATPEKWDIITRKAGDRTYTELVRLLIIDEIHLLHDQRGPVLEALVARTIRMTEQTQE
NVRIVGLSATLPNFADVQNFLRVKPLNKKENTGGMFFFDHTYRPVPLQQSFIGISEKKAA
KRMLLTNEILYQKVEQRASKDQPLFIFVHSRRDTVKTANFLRQQAYQMNELNKFVEEGSN
AEEILKKAAENIQNKDLKEMIVQGFAVHHAGLSRDDRDIVENLFFQNRYQKTIKVLVCTA
TLAWGVNMPASCVIIKGTQVYSPELGKWTELSPQDMIQMVGRAGRPGFDLRGESIVITSF
QEKNYYLSLLNQQLPIESQFISQLPDQLNAEIVLGTVSNIKEAVDWLGYTYLYIRMLRSP
KVYHISDEEYENDRLLVKHRANLIHSAATLLDKYGLIKYDKKTGIFQSTSLGKISSHYYI
KYPSMEIYNKHLKQNMGVIELLKVFSLSNEFKYIPIREEEKAELSRLMESVPIPVKGSIE
EPSSKINVLLQAYIGKLPMEGYALNADMIFVTQSAGRIMRAIFEISLKRGWAYVAENALN
LCKMIDKQMWSCMTPIRQFRQSSNKKFGKIGESIFRKIEKIEQMTFNRLKAMNEQQLMEL
LKTGDTKNNKLGAILKNRIRMMPELKITVDKIPITRSCLQVTITIDKGDFQWEDSFHGDS
EPFWILVTDCDEEELLYHEYFTAKKHKLCAKRSEDEQSPYVFQFIVSLFENLHPVYYIKV
ISDRWIQCETIEPLFFKDLILPEQFSAPTKLLEFQLVPTSELRFPEGEAVLKELGITTFN
KIQTQVLNQFYSQSENIFLGAPTGSGKTACIIVAMLRIFKTYYENKKVIYVAPFESICQN
MYKLFSKAFKHLGKKVAILTGQTKTDNQIFTKYDIIISTPENWDINTRKWKKTQQIINKN
IKLFIADELHMLNECNSTYEVIVSRMRQFSSLLSSKSEGKQEGKKEVNHNFQIIGLATSV
ADYKEMASWIGANPSNTFNFSPDVRPYPVDLHITGFEQHHRKARLISMQKHMYQGLKLFL
KSPQQQGIIFVSDRKQAKITAIDLQTLAAGDNNPQKFLKVPYDSIQEIVESLRDLSLRQS
LKYGVGFIYEGMSEQEREVVESLYQSGAIQVLISTYKLCWELNLHSQVVIILDNQRYDGR
EKRYIDYTIPDMLQMIAYAKSKNASAQNAQAAKCLVFCHSPKKEYYKKFLFEPFPVESIL
SENITNHICGEIYAERITSLPACIDWSTWTFMYRRLSQNPYFYGLREVSGPAINDFLCDL
FEKAIEYLIEYKCVKELEQHNLALLSLGSIAGYYYIDVQTIQMFNERIKPDQSTKHLINI
ICSANEFLDIPVRHQEENLLKQLNQQIMYPVDSSIEVFNDPNVKAYILLQAYFSRLNLSA
DFSYDQKLVLDKAVNLTHGLIEVINSNGLPKEAIKAMRFSHMIVQAVWTDSSPLLQLPHF
NEKIVKALADLDVKSINDLLNNDEARDQVFEQFKFSESEIEEIANAANRYPDINFTYSIQ
NVNSIYEGDDKVNMKISITREGEDYTDFVVAPYYPKQKEELWWVMVADTNKNILRCIKKL
GFKQKADVDFQFDVPEAGSHELRIILMCDSYLGCDTGKQFTLNVKRRGANGSMEDE


>TTHERM_00302060(gene)
ATGGCCGATTAGCGTTAGGTTATTGATCAATTCAACACAGTAAATATATTTACATTATCA
TAAAAAAAATATCAAATCTAAGATATATTCTGAAAATGAATATGCAATTAACATTATTTC
CGTATTAAAAAGCAAGCAAATGAAGTTATTTAAGGAGAAAGATAAAGAGGAGATGAGAAT
ACTGGTGAGCCTATTTCATTAGTAGGTCATTTAGATTCATTGAAGATGGGTGAATATGCT
GTCAGATAAAATCCTAAAAAGATTTTAGATATGATGAAAAAGAATGAAGACTCAAAGCTC
AAAAAAAAGAAAGCAGACAATTTAGTTTAACCTAAAAAGAAAACTAAAATAGTAAATTTT
GATCAAAATTATTAACTAAATTAGCAAGTTAAATTAAAATATTTTTTCAATTTAAAAAAA
TAGAAAATTGAAAAGAAAGATATTTTGAATGCTGAAATTGACCCTTCAATTTTATATAAG
GTAAGATTTATACAAAAAAATATTCTCGTTATCTATTTATTTATATGCATGTTTATTTAT
TTATTATTTATTTTTATAAATTAAGACATGTATTTGATTTTTATATTAATTTTTCATCTT
TATATAAATCTCTATAGCCTAAAACTAACGAAAACAGGATATTGTACGAGAGTATCTTAA
GCAAAGTTAACAAAATTTTAACAGATTAGCCAAGAGATGTTCTCATAAGTGTAACAGATA
ATATTCTTGCTACCTTGAAAAATGATAATTAGAGAGATAAGGAGAAAAAAAAAGAAATTG
ATTAGCTTATCTAGACTGAAATTCCTTAAGAAATATTTGATTCCTTATTAACTACTGCAA
TGCAAATCAATGATTACAATTAATCTTATGAATAAAATGAATAAAAGTATGGCAATGATG
AAGATCAAGATATGGGTATTGATGAAGAAGATGATGAAGATGATAATGATGATGATTAAA
TCTAAGCTTAAGTTTAAGATTAGCAAGATATTGATGAAGAAAGTGACTAAGAAGATGAAG
ATTAGGAATAAAATTAATAGATTAAAGCTCTTAATGTAAATATTTTTTTAATTACGTTTT
AATTAAGCCCTTTTAATATTTATTTTGATGAAATACAGGGAGACAACTTTAGCAATCAAA
ATGAAAAGAATGATCCTAACAATATTGATGTTAGAGCTATTGATGCATATTGGCTTTAAA
CCAAATTAAATGATGTAATAAAATAATATTTAATTTAAATGTAAACAATCTATTTACCTT
TTGAAAATTTACTATGAATAGATTTATAACGACCCCATGTAAGCTTAGAAAAAAGATAAA
GAAATATTGTCTGTGCTTAATGAACAAAATAATATTATTTGTCAAAGTCAATTAATTAAG
ATATTAGGTTATGATTAGTTTGATTTAATTTCTTTGCTTGAAAAAAATAGGTAAACCTCT
ATTTAGAAACTTTTATTTATAAACTAAATATTTTCTTTAATATTAAAACAGACACAAAAT
TTACTTTTGCACTTTGCTTTAGAGAGCTGAAAAGTAATAGGAAAAAGATTAAATCATTGA
GTAAATGAGATCAACAGAAGCAGGAGAAAGAGTATGGGAATAATTACAAAATATTGATAA
AAAATATAAATCAGATCATTTAAATAAATTTGACTCTAAGAGCAAGATGGCTAATCTTAA
GGGTAAAGAAATGGATATTGAAGAGCTTATTACTGCAAACAAGATTACAGATGAAGTAAT
TCAATTAGTTTCAACTATTTTTCCATCAAATTAATTTCTTTTCAAAATTTTAAGGAATTC
AATAAAATCAGTAAGAAAATACTTGACTTAGAAAGTTTAGTTTTCTAAGAAGGTTCTCAC
TTCATGAGCACTTAGCAATTCACTGCTCCAGAAAGAGCCACTAATTGTTCTTATAAAGGA
TACGAAGAGACAATTATAAATGCAACTTAAATCAAAGTAAATTATTTATTTAATTCATTT
TCATCTAATAGTTTCTTGTAAAATAATCAGATAAACGCAGAATTAAAATAAGTTACAGCA
TTACCTGAATGGGCCCAAAAGCCTTTCGTAGATAAAGAAGTTAATATAAAAGAATTCAAT
CCAATTTAATCAGCCGTGTTTGATTGTGCTTTTAACAGAACTGAAAATATGCTGGTTTGT
GCACCTACTGGAGCTGGTAAAACAAATATTGCCTTGCTTGCGATTCTTAACGTCATAGGC
AAATATATTGACCGTAGAGGAGTTGTGAATTTAAACAAATTTAAAATTGTTTATTTGGCA
CCAATGAAAGCCTTGGTTGGTGAAATGGTTTTAACATTCACATAGAGACTTAGTAATTAA
TTATTCTTAATTTAATTAATTTTAAAATATTTAAAAATTTCCTTTCATAAATATTTTTAA
TCTGAATTTATTAAAATATTTTTTCACTAAATAGAATATTACGGCATTACTGTAAGAGAA
CTTACAGGTGATAGTTAATTGTCTAAAGAACAAATCGATTCAACTTAATTGATTATCGCT
ACACCTGAAAAATGGGATATTATCACTAGAAAGGCAGGAGACAGAACTTATACAGAGCTT
GTTAGACTTTTGATTATTGATGAAATTCATTTATTGCATGATTAAAGAGGTCCAGTCCTT
GAAGCTTTAGTTGCAAGAACTATAAGAATGACTGAATAGACCTAGGTAATTTATTTTATT
TATAAAAGATAAGTTATAATTATTAAAATTATTAAATAAATAGGAAAATGTTAGAATAGT
TGGTTTATCTGCAACTCTTCCAAATTTTGCTGATGTTTAGAATTTCTTGAGAGTAAAGCC
TTTGAATAAAAAAGAAAATACTGGTGGTATGTTCTTTTTTGATCATACCTATCGTCCTGT
CCCTCTTTAACAATCATTTATTGGTATTTCTGAAAAGAAGGCAGCTAAAAGAATGCTTTT
AACAAATGAAATCTTGTACTAGAAAGTTGAGTAAAGAGCTTCTAAGGATCAACCTTTATT
CATTTTTGTTCACTCAAGAAGGGATACTGTTAAAACTGCAAATTTTTTACGTCAATAGGC
TTACCAAATGAACGAATTAAATAAATTTGTAGAGTAAATAAATTTATTAGTTAATGTATT
AAAAATTTTATATTAAATTTATTTTAATTTTAAGAGAAGGGTCAAATGCAGAAGAAATTT
TAAAGAAAGCTGCTGAAAATATCTAAAATAAAGATTTGAAGGAAATGATTGTCTAGGGAT
TTGCAGTCCATCATGCTGGTTTAAGTAGAGATGATAGGGATATTGTAGAAAATTTATTCT
TCTAAAATCGTTATTAAAAGACAATTAAAGTTTTAGTTTGCACAGCCACTTTAGCTTGGG
GTGTTAATATGCCTGCTTCTTGTGTTATCATAAAAGGTACTTAAGTTTATTCTCCTGAAC
TTGGTAAATGGACTGAATTGAGCCCTCAAGATATGATCTAGGTAAATAGCTGATTTATTT
CTTTAAAAATTTTCTTTTTAAATAAATCTTAAATTACCCAAACAATTATTAAGTAAACTT
TTTTTGTAAATATAAGATGGTTGGTAGAGCTGGTAGACCTGGCTTTGATCTAAGGGGAGA
AAGTATTGTTATTACCTCTTTTTAGGAAAAAAATTACTATTTGAGTTTACTTAATCAATA
ACTACCTATTGAATCCTAATTCATTAGTTAACTCCCTGATTAATTGAACGCTGAAATTGT
ATTAGGAACAGTGTCTAACATTAAAGAAGCTGTTGATTGGCTTGGTTATACATATTTATA
TATTAGAATGTTGAGAAGCCCTAAGGTTTATCATATTTCAGATGAAGAATATGAAAATGA
TAGACTCCTAGTAAAGCATAGAGCTAATTTGATTCATTCAGCAGCTACTTTACTGGATAA
ATATGGACTTATAAAATACGATAAGAAAACCGGTATTTTCTAATCGACTTCATTAGGTAA
GATTTCATCTCACTATTATATCAAATACCCTTCGATGGAAATCTATAATAAGCACTTAAA
GCAAAATATGGGTGTTATTGAGTTACTTAAGGTTTTCTCTCTTTCTAATGAATTTAAATA
CATTCCTATTAGAGAAGAAGAAAAAGCTGAACTCTCTCGTCTCATGGAAAGTGTACCTAT
ACCTGTTAAGGGTTCTATAGAAGAACCTTCTTCTAAAATAAATGTTCTTTTATAGGTAAT
TTAATTAAACAAATTATATTCACTCATTCTTTCCAATAAATAGATTTTCTAAATATCTCA
TTCTAAAAAAAATATTGAATATATAAAAGGCTTACATTGGTAAATTACCTATGGAAGGAT
ATGCATTGAATGCTGATATGATTTTTGTTACATAAAGTGCTGGACGTATTATGAGAGCTA
TATTTGAGATTTCATTAAAGAGAGGATGGGCTTATGTTGCTGAAAATGCATTAAATCTTT
GTAAAATGATTGATAAGTAAATGTGGAGCTGCATGACACCTATCAGATAGTTTAGATAAT
CAAGCAATAAGAAATTCGGTAAAATTGGTGAATCTATTTTCAGAAAAATAGAAAAAATAG
AATAAATGACATTTAATCGTCTAAAAGCCATGAATGAATAATAATTAATGGAACTTTTGA
AAACAGGTGATACTAAAAATAATAAGCTTGGTGCCATTCTTAAAAATAGAATTCGTATGA
TGCCAGAACTTAAAATAACTGTAGATAAGATTCCTATCACAAGAAGTTGTTTACAAGTTA
CTATTACTATCGATAAAGGAGATTTCTAGTGGGAAGACTCTTTCCATGGTGATTCAGAGC
CATTTTGGATATTGGTAACTGACTGTGATGAAGAGGAATTACTTTACCATGAATATTTCA
CTGCAAAGAAGCACAAATTATGTGCAAAAAGATCCGAAGACGAACAAAGTCCCTACGTTT
TCTAATTTATTGTAAGTCTATTTGAAAACTTGCATCCTGTATACTATATCAAAGTTATTT
CTGACAGATGGATTTAGTGTGAGACTATTGAACCTCTTTTCTTTAAAGATTTAATCCTCC
CTGAGTAATTCAGTGCTCCTACTAAATTGTTAGAATTCTAGTTAGTACCCACATCAGAAT
TAAGATTCCCTGAAGGAGAGGCTGTTCTAAAAGAATTAGGTATATTATTGATTCATTCAT
TTAAGAAATCAATTTTGAACTAATATTTTTTTCTTTAAATGACAATTTTAATTTTTTTAA
TAAATATAAATAGGAATTACTACCTTCAACAAAATATAAACATAAGTTTTGAATCAATTT
TACAGTCAATCTGAAAATATATTCCTTGGAGCTCCTACTGGCTCAGGAAAAACAGCTTGC
ATTATTGTTGCTATGCTAAGAATTTTTAAAACATACTATGAAAATAAAAAAGTAATTTAT
GTGGCACCTTTTGAATCTATTTGCCAAAATATGTACAAACTATTTTCTAAGGCTTTTAAG
CATCTTGGCAAAAAGGTTGCCATATTGACTGGTTAAACTAAAACAGACAACCAAATTTTT
ACCAAGTATGATATTATTATATCTACACCTGAAAACTGGGATATAAACACTAGAAAATGG
AAAAAAACACAATAAATCATTAACAAAAATATAAAACTTTTCATTGCTGACGAACTCCAT
ATGCTTAATGAATGTAATTCAACTTATGAAGTTATTGTTTCTCGTATGAGATAGTTCTCT
TCATTGCTTTCTTCTAAATCAGAAGGCAAATAAGAAGGCAAGAAAGAAGTTAATCATAAT
TTTCAAATTATTGGTTTGGCTACTTCTGTAGCTGACTATAAAGAAATGGCATCATGGATT
GGTGCTAATCCTAGCAATACCTTTAATTTCAGTCCTGATGTTAGACCTTACCCTGTAGAT
TTACATATTACTGGTTTTGAATAGCATCACAGAAAGGCTCGTTTAATTTCTATGCAAAAG
CACATGTATTAAGGTAATTAATTTATTCTTTATTTTGGACAAGCAAAATTAATTTAATTA
ATTTATTCAAAGGTCTCAAATTATTCTTAAAATCACCTCAATAGTAAGGCATAATTTTTG
TTTCTGATAGAAAGTAAGCTAAAATCACTGCTATTGATTTGTAAACTTTAGCCGCAGGTG
ACAATAATCCTTAGAAATTCTTGAAGGTTCCATATGATAGTATTTAAGAAATAGTCGAGT
CATTAAGAGATCTCTCTTTGAGATAATCATTAAAATATGGTGTCGGATTTATCTATGAAG
GTATGAGTGAATAGGAAAGAGAAGTTGTTGAGTCACTATACTAATCTGGAGCTATTTAAG
TTCTAATCTCAACATACAAATTATGCTGGGAGCTCAATCTTCACTCTTAAGTTGTTATCA
TCCTTGACAATCAAAGATATGATGGTCGTGAAAAGAGATATATTGATTATACCATTCCTG
ATATGCTTTAAATGATAGGTAAATTTCATTTTATTTGGATTTAAATTAATTTTTTATACT
TCAAAAAAATAGCTTATGCTAAGAGTAAAAACGCAAGTGCACAAAACGCTTAAGCAGCTA
AGTGTTTAGTCTTTTGCCATTCTCCAAAGAAAGAATATTATAAGAAATTCTTATTTGAAC
CTTTCCCTGTAGAATCAATCTTATCAGAAAACATAACTAATCACATTTGTGGTGAAATTT
ATGCTGAAAGAATTACTTCTTTACCAGCTTGTATTGACTGGAGCACTTGGACATTTATGT
ATAGAAGATTATCTTAAAATCCTTACTTCTATGGACTCAGAGAAGTTTCAGGACCTGCCA
TTAATGATTTCTTGTGTGATCTATTTGAAAAAGCTATTGAATATTTAATAGAATATAAGT
GTGTTAAAGAATTAGAATAGCACAATTTAGCTCTTTTAAGTTTAGGTTCTATTGCAGGAT
ATTACTATATTGATGTATAAACAATATAAATGTTTAATGAGAGAATAAAGCCAGGTAATT
TTACTTTGTAATTTAATTTTTATTTCTTATTTTTTTTCTTTTACATTCTTAGACTAATCA
ACAAAGCATTTGATTAACATCATCTGCTCTGCAAATGAATTCTTGGATATCCCTGTTCGT
CACTAAGAAGAAAACCTATTAAAGTAATTGAATCAATAAATTATGTATCCTGTAGATAGT
AGCATTGAAGTTTTCAATGATCCAAATGTGAAAGCATATATTTTACTTTAAGCTTATTTC
TCACGCTTGAACCTTTCTGCAGATTTCTCTTATGACTAAAAGCTAGTTTTAGACAAGGCA
GTTAACTTAACACACGGATTAATTGAAGTTATAAACTCAAATGGCTTACCAAAAGAGGTA
AATTATATAAAATTTTATTATTAGCTTATATTGATGAATTTAATTAGGCTATAAAAGCAA
TGAGATTCTCTCATATGATAGTGCAAGCAGTCTGGACTGATAGCTCTCCACTTTTATAAC
TTCCTCACTTTAACGAGAAAATAGTTAAAGCTCTAGCAGATCTTGATGTCAAATCAATTA
ATGATCTTCTTAATAATGATGAAGCTAGAGATTAAGTTTTCGAATAGTTTAAATTCTCTG
AATCAGAAATCGAAGAAATTGCTAATGCAGCAAACAGATATCCTGATATTAACTTTACAT
ATAGCATTTAGAATGTAAATAGCATTTATGAAGGAGATGATAAGGTTAATATGAAAATAT
CAATCACAAGAGAAGGTGAAGATTATACTGATTTTGTTGTTGCACCTTACTATCCCAAGG
TAATTTATTTGGTATTCTAATTTGTAGTATTTACTTATTTCAAAAATAAAATTAGTAAAA
AGAAGAATTGTGGTGGGTAATGGTTGCAGATACCAATAAAAATATACTTCGTTGCATAAA
AAAGCTTGGTTTTAAGTAAAAGGCAGATGTTGACTTCTAATTTGATGTACCTGAAGCTGG
TTCTCATGAACTAAGAATAATTTTAATGTGTGATTCTTATCTTGGCTGTGATACAGTAAA
TAAAAAAAATTAATTTATTTAAACAAAAATTCTAATATTTAATTTTAAAAATAGGGAAAA
CAATTCACTTTGAATGTAAAACGTAGAGGTGCTAATGGAAGTATGGAAGACGAGTGA