Identifiers and Description

Gene Model Identifier

TTHERM_01034400

Standard Name

DRH33 (DExD/H box RNA helicase 33)

Aliases

PreTt22676 | 205.m00065

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_01034400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_150480
WormBaseWBGene000131899.997093137033517e-262status:Partially_confirmed U
niProt:Q9XWI1 protein_id:CAA
21686.2
Tetrahymena borealisEI9_20046.19.997093137033517e-262type III restriction enzyme, r
es subunit protein (2631 aa)
DictyBaseDDB_G02903899.997093137033517e-262ascc3 on chromosome: 5 positio
n 4020336 to 4027033
OxytrichaContig18508.0.g439.997093137033517e-262Sec63 Brl domain
SGDYGR271W9.997093137033517e-262SLH1 Putative RNA helicase rel
ated to Ski2p, involved in tra
nslation inhibition of non-pol
y(A) mRNAs; required for repre
ssing propagation of dsRNA vir
uses

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01034400(coding)
ATGAGTGATAAAGATTTAGGAGAAGGTAAAAATAAGCACTTCATTACAACCTTAGTCCAC
TATGCAAATAAAGAAAAATGCAGATTTACTTGGAAGTTAAGGGAAAAAACGTCAGGTTAC
GAAAACAATGACGATAATACAGTTAAAAGAACTAAGAATCAAAGAGAAGATTACATTAAA
AAATATAAGGATACTTCATATGAGGACGAGTAGACTGAGATGAAATTAAGAAGAATGGAT
ATTATTTATAGATTATACTACACTGAAGACGCAAAATTACGAAAATTAATGATGGATTAT
AAGACTTATGTTAAGAAGATAGGAATAGATATATAAAAGCTGGAAGAACATAGTGAATTA
TAGCATAATTTAAGATGCGTTGGCTATTATTAGGGTATTTATAAGATGTATAAGGAAGCT
TAACTTAGACCAGATGAATGCAATCTTGTCTTTATGTAATTGATGAAGAAAGACTATGAG
CCAAAATATAAATTAGAAAACAGCGAAGAACCTTATAATTTATTATTGAGTTTGTTTTAT
ATCATAGAAGATATGCAAAAGCAGATCATGGAAACTCCAATTTTTGATGAAAAGGATGAG
TCTAAGACAAAAATTATAAAAGAGTATAAGATGATTGATGAAGATTCTAAGCCTTTAGAA
TATGTTGATTCTTATAATGAAAATACGCATGAAAACATTATTGAATTCAGATATGGTTAT
GATTTGTTTGATGAATTCAGAAGTGATGAAATAGTTTAAATCAGATAAAAAGAAAAGCTC
AATTATGTTAAGGAGTTCTATGAAAGATATGAAGATGTTTTGAAAAACAAATCACCTGAT
TTTTGGTAGTTTTTATTGTTTGATGTTTTGAAGGCGTTGTGCAACAAAAGTAATACTGAT
GAACAATTGCAAGAAATTCTCATGAATCTTTTGGATGACTTTGATGCTTGCAGATTTTTG
CTTTCTAATAGAAAAGAAATCATCCTTTACTTGTATAAAAATCACTTCGCAAAGGATAAA
CAATTCTCATCCTCAATAAGCTCTATGAAAACTGATGACTCGCAAGGTTTGACCAACTAT
GAAATTTTGAAGTCAATTGGTATGAAAGATATAGATATCGAAAGGGAGTCTAGATTAGGA
TTAAAGAAAAAAGATTTAGATTAAAAAGTTTCATAGGCTTAAAGCAAAAATTAATATGAT
GTTGATGACGAATTTTCTGAAATAGATTTTATCAAATAAGAATAAAGTTAATTAGTATAA
AGAATTCCCTCTCTTGAAAAAAGTGATTATCCAGAATACATTTAACTTAAAATATCTCCA
ATGCCAAGACATCACACTCACGTTACTGATCTTGTTAAAATCGAAGGAAATTTCCCTGAT
TGGGCAAGAGAAGCATTTGGTTCAATTTAGTCATTAAATGTAGTACAATCCAAAGTTTAC
AAAACTGCCTTTTAGACAGATGATAACATTTTAATTTGCGCCCCTACTGGTGCTGGTAAA
ACAAACATCGCTTTGATGACTGTTTTAAGAGAAATAGAGAAACACATCAATCCTCAAACT
AAATAGCTTATTGATCCTACTTTTAAAATTATTTATATTTCCCCTATGAAGGCATTAGCT
AGTGAAATAGTAGACAAATTTTCAGGAATGCTTAAACATATGAATGTTAAATGCAAAGAA
TTAACTGGTGATATGCAACTCACTAAAAAGGAAATAGAAGAAACATAAATTATAGTTACT
ACCCCTGAAAAATGGGATGTCTTCACACGTAAGAAAAACGAAGTTGCTGAAACTCTTCGT
TTGTTAATTATTGATGAAATCCACTTACTTAACGACGAAAGAGGTCCTGTTTTAGAATGT
TTGGTTTCTCGTACTCTACAAAATATTGAAAGATAGTAAAAATCAGTCAGAATGCTTGGT
CTTTCTGCTACTCTTCCTAACTATTTGGATGTCGCTTCTTTCCTCCACGTTAAAAAGGAA
TCAGTCTTTTTCTTCGATGCAACATACAGACCCGTTCCTCTCATGCAAAGATATATTGGT
GTTAGAGAACCAAAATAATCAGGCTTTAAAGTGAAAAGAAAGAAAATCGATATTTATAAT
GACTTGTCTTATTCTATTTCTAAGGGTATTTTAGAGCACAAAAAGCAAGTTTTGATTTTC
GTCCATTCAAGAAAAGAAACCATAGTTACTGCTTAATATGTATTGAAGAAAGCTCAAGAT
TGCGGAGAATTGCATTTGTTCAAGCCAGTTAATAGCGATAAGCATTCCTTACCAAAAATT
AAAGACAAGGAACTATAAAAGTTAGCTCCTTGGGGTTTAGGTTTCCATCATGCAGGTATG
TTGAGAAAAGATAGAAATATTGTTGAAAAAATGTTTAACGATGGCCAAATTAGAATTCTC
GTCGCAACAGCTACTTTAGCTTGGGGTGTTAACTTGCCTGCTTATGGTGTTATCATTAAA
GGTACTGATGTTTACGATCCAAGCAGAGGTGGAACTTAGGATTTGTCTGTTCTCGATATT
TAATAAATGTTTGGTAGAGCTGGTAGACCTTAGTTCGATAACAATGGTGAGGCAACTTTG
ATGACTGATATAAATAAATTGAACTCCTTTGTTGCTCAATTAAATAATGCAAGTTTTATT
GAAAGTAGATTTACAGCACACTTAAAGGAAGCCCTTAATGCTGAAATAGCTTTGGGAAAT
ATAGCCACATTAAAAGAAGCATTTGATTGGGTTAACTACACTTTTTACTCTATCAGATTG
AGAAGAAATCCTATGGGTTATGGTTGCAAGATAGCTCAAAATAAAGAACTCTCTATAGAA
ATGCATATAACAGAAACCATCGAAAATGCACTTGAACATTTAGACAAGTTGAGATTGATC
AGATGGGACAGATAAAATAATTATTTAGCATCTACAGAATTGGGTAGAATTACCTCTCAC
TATTATATTAATTGCGATACTATGAACACTTTTTGCAAAGGGTTTGGTATTTCTCTAGAT
AATGATGAAGACATTGAAGAAAATGAGTAAAAGAGAACTGAATATAAATCCGATTTAGGC
ATATTAAAGATTATTTCTCAAGCTAAGGAATTTGAAAATATCAAGATGAGACCAGAAGAA
ACTGAAGAACTTGCTGTAGTTATCAAGAAATACTGGATTTTTGAAGAATAAATTGATATC
AACATTAAGAAAATAGGCACAAACGATAGCACTTCAGCTGATAATAATACTCTTCTCATT
GATACACCTGAAAAAATCTTAGCTCTTATTTCAGGTTATCTTACCAAATATCAATACGAG
AACTTTTCACTCATATCTGACTCTTAATTCGTCATTCAAAATTCAATCCGTCTATTGAGA
TGTATGCTCGATATAGTCACTAAAAAATCTATGGCTTCTAACGCAGAGCTTGTTCAAAGA
TGGTGTAAATACATTGAATCCAGACTAGTCCCAGACGAAAGTCCTCTCCATCAATTCTGT
AAATCAAACTGGCAAGGATATAACTCATTCAAGCAAAGAAAAGAGTTCAAGGATGGTTTC
ATCTCTGAAGATGTCGTTTATAAGATTGATGACAGAGAAATAAGCTTGGATACAATAAGA
GAAATGCCAGCTACTGAATTAGCTCATGCTATTAATTGGAATACAAGAATTGCTACTGTT
ATTAAAAAGTTTGTTTGTTTCATTCCTAGAGTTGAGGTTGAATATTCTGTTCGTCCTATT
GCTTAAACAGTCCTTAAAGTAGATGTTTTAATTACACCAAAGTGGTCTTGGTCTAATAGA
TGGCATTCTAAATCTGAATTGTTCAATTTAGTTGTTGATGATGAAAATGAAATTTTACAT
CACGAAAGCTTTACAATCAGCTAACAATAAGTCTTTACTTCAACTCCTACTGAAATAAGT
TTCTTCGTTCCTTTCAGAGACTCCAAGGTTCCCTATTACAGATTACTTGTTTAGCATGAC
ACTTGGGTCAACTAACCTGAAACTGAAGTACAAATTAATTTAGAACATATTTATTTCCAA
GGTGAGAAGATGGAATACACTGAATTGCTTGATCTCCATCCCTTACCTATTTCTGCCCTT
AACAACTCTGATTTTGAGCAAATTTACAAAATGAAATACTTCAATCCTAATTAAACTCAA
ATATTCCATGCAATGTACAACACTGACCACAACATTCTTATTGGTTCTCCCACAGGTTCT
GGTAAAACCATTATGTCCGAATTATCTGCCCTTAGAGTTTTCAACTTATATCCTGAAAAG
AAGGTTATTTATGTAGCACCCTTGAAAGCTATAGCTAAAGAAAGATTAGCAGATTGGGAA
GTTCGTTTTGGAAAAATTGGAAAAACTGTGCTAGAATTGACTGGTGATTACACTCCTGAT
TTAGATGCATTGCTCAAGGCAGATGTTTTGATTACTACACCTGAAAAGTGGGATGGTATT
TCACGTAACTGGCACAATAGAAACTATGTCTAAAAGACAGGTTTGGTTATTTTTGATGAA
ATCCATTTGCTTGGTTAAGACAGAGGACCTGTTTTAGAAGTTATTGTTTCCCGTATGAAT
ATGATTTCCTCAAAAACAGGACATAAGGTTAGAATGGTTGGTCTATCTACAGCTATGGCT
AATGGTACAGATGTTGCTGATTGGTTTGGTGTTCCTAAAAATTATTTCTTCAACTTTAGA
CCTCACGTTCGTCCAGTTCCTCTTAAAATCTATTTTGATGGTTTTAGCGCAAAAGCATAT
TGTCCTAGAATGGCTGAAATGAATAAGCCTGCCTTCTAACAAATCAGAAAGTTTGGTGAA
AAGAAACCCGTTCTTGTTTTTGTTTCATCAAGAAGACAAACAAGATTAACTGCTTTAGAT
TTAATAGCTCATGCCATGCATGATATCGGTGGCGGATAGAGTCCTTTCGTAATGTGCTAA
GAAGACGAGCTTTAAATCTATTTAGAAAACGTTAAAGATGAATATCTTAAATAAACCCTC
TCATTTGGTATCGGTATGCATCATGCAGGTTTGGATCAAGATGATAGAAAAATTGTTGAA
GAATTGTTCTTGAACCACAAAGTTTAAATTTTAGTTGCCACTTCAACTCTAGCTTGGGGT
GTTAACCTTCCTGCTCGTTTGGTAATCATTAAAGGTACTGAGTATTTTGATCCTAAGACA
AAGAGATATGTAGACATGCCTGTTACTGATATTTTATAGATGATTGGTCGTGCTGGTCGT
CCACAATTCGATGATAAAGGTATTGCTTGTGTTTTTGTTGAGTAAAGCAAAAAGAATTTC
TATAGAAAATACTTGAATGATCCTTTCCCTATCGAATCATCTCTTATCAGCCAAATCCAT
GACCACTTTAATGCAGAAATAGCTAGTGGTACTATTACTAACAAACAATAATGCATGGAT
TGGATTACATGGACATATTTCTTCAGACGTATGCTTAAAAATCCTACTTATTACAATTTA
GAAAACGCAGAAACCAAGCAAGTTAAAAAGTTCTTAATTGAGTTGGTCGATGAATGTATG
AACAGACTAGCTGAACATGGTTGCATAACCATTGATGACGAATTAAAATTCAATGTTACT
CCAACTTTCTTAGGTTAGCTTGCTGCTTTCTACTATATTAAGCACGAATCAGTTTTCTAC
TTTGAAAAAAATCTAACTGCTAATATTACTATCCCAGAACTTATCAGAGTTCTTTCATAC
TGCAAAGAATTCGAAGAAATTCCTCTCCGTCACAACGAAGAAAATTACAATGAAGCTCTC
TCTAAGATTTGTCCTCTTAAGTGTGATAAGAGTGCTTTCAGTTCTTCAAATGAAAAAACT
TTCCTTCTTTATTAAGTTCACTTATTTAGATTACCTCCTCCTATTAGAGATTACATTACT
GATGCAAAGATCGTTGTTGATAGTTCTGTTCGTATTTTGAGTGCCATGATCGACTTAGTA
GCTGAAAAGAGATACTTGAATACATGCATTAATTTATGTATGATCATGCAAATGATTATG
CAAGCTGTTTGGTTTGATTAGAGTCCATTAATCAATGTTCCTCACTTCGACTAGCAGATT
GTGAAGAAATTGGGATTGGTCCACTTCTGTCAATTAATAGAAGAATATAAAAAGGAAACT
CTTCGTCCTACTCTAAAGAAGATAGATAAGAAATTCGGTGATGATAAACTCTGGAGAGAA
GTCGAAGAAGCTATCAAATCACTACCAGATATTTCCTTTAGGGCCAGAATTTATCCTTTC
GACTCTGAAAAATTGCAAAAGCAAGATGTTAACTTGAAACAATCTGAAATTTAACTCACT
GAAGGAGGTGAAGCAGTGGTTTAAATTATTATTGATAAGGAGAATGAAAAATATCCCAAT
AAGGTGATTGTTTAGAAGACAGGAAAAATTAAAGATGCATCTTGGTGGGTTTTAATTGGT
GATGAATACACAGGCAAGCTTCATGCTTTGAAGAAAATATTCTTCAAAAAGAATTTAAAG
AAGGATATTCAAATTATTTTACCTGAGAGCTTCGAAACTAGCAAAAAGCTGACTGTTTTC
TTGGTTTCTGATTCATATCTTGGATTAGATTAAGTTTTCTATTTAAATTTAAGAAGCAAA
GACTAAAAAGCTGATGAAAAATATTAAGCCTAAAGCGATGAATCAGATAGTGACATTCCA
AAGCCAATTAGATAGAGACTTAGTGATGATGAAGATGACAAACAAAAGAAGAAAGAAAAG
CCTTCTTATCCTAAATTCTCTAAAGGCAACACATTAAAGAAGAGCAAGGCAAAAGAAGAA
GAAAATAGCGATGAAGAAGAAGAAGAAAAAGATTAATAAAAAGAAAGTCCTGAAAAGAAA
CAAGATACTAGTGACTAAAAGCAAGAAGATAAAAAGAAAAATATTCTTTAGAAAAAGAAA
AAAGAAGGAGATGATGAAAATAGTAAAGCTAACGATAGCAGGAAAGATGATGATAAAGAC
TTTGATAGAAGCAAAGGAAATAACCTATATAAAAAGAAAGATGACACTTAAAAGTAAAAC
GAAAAGAAAGAGTCTGACTAAAGTAACAATAAATAAGAGAGAAAGGATCAACCTGCTAAA
GGAGGAGATAATAAAGATTTTAAAAAGAAAAGGGATAACAGAGAACGTAAGCCTAAATAC
AACAATGATAGAAGACAATAAGATTCTGAAGATGAAGATGAATATGATGTAGGCTATAAG
ACTAAAGAGGGCTCTCACATCGATGAATTCACTCGTAAAAGAAGAGAAGAAAAGAATATG
GATAAACTTGATAACTAAAATAATGCTCAGAATGAAGATGACGAAGATATAGTTTAAAAA
ATAAAAGAAGATAGTGACTTTAGTGATGAAGAAGAAGAAAACCAAAGATCAAAATACAGA
AATAAAAGAGGTGGCGGTGGTGGATAAAACTTTAGTCGCGGTAGTGGTAACTAAGGTGGT
AATAAATACACTGGAAATTAATTAAGAAAGAAAAATGATGACGATTACTAACCCAGACAA
AGAGAAAATGATGATTAAAAAAAGAGAAATTTCTAAGGCGAGAGAAAGTTCAATGAAAAT
TAAAATTAAGGAGAAAAGCGTGAATATGAGAAGAAGCCCTACGAAAAGAAGCAATATGAA
AAGAAAGAAACTCAATTCGTGCCAAAAGAAAAGAAAGAACCTGTTTATGAACCCAAAGAA
AATCCATCCTCTTCTTCTTAATCCTAACAATAGTAATAAAAATCAGAGGCTCCAAAACAA
CAAACTCAAACTAAGCCACCACCAACTGGTTTTAAACTAAGACGTAAAAATAGCGACGAA
TTAAATGCAGAAGATAAAAAGAGTTCAAACAATAACAATAATAATAGAAATAATAATAGT
AATAATAACAACAACAATAATAATAACAGAGGTGGCAATAACTCTAAGCGTTGA


>TTHERM_01034400(protein)
MSDKDLGEGKNKHFITTLVHYANKEKCRFTWKLREKTSGYENNDDNTVKRTKNQREDYIK
KYKDTSYEDEQTEMKLRRMDIIYRLYYTEDAKLRKLMMDYKTYVKKIGIDIQKLEEHSEL
QHNLRCVGYYQGIYKMYKEAQLRPDECNLVFMQLMKKDYEPKYKLENSEEPYNLLLSLFY
IIEDMQKQIMETPIFDEKDESKTKIIKEYKMIDEDSKPLEYVDSYNENTHENIIEFRYGY
DLFDEFRSDEIVQIRQKEKLNYVKEFYERYEDVLKNKSPDFWQFLLFDVLKALCNKSNTD
EQLQEILMNLLDDFDACRFLLSNRKEIILYLYKNHFAKDKQFSSSISSMKTDDSQGLTNY
EILKSIGMKDIDIERESRLGLKKKDLDQKVSQAQSKNQYDVDDEFSEIDFIKQEQSQLVQ
RIPSLEKSDYPEYIQLKISPMPRHHTHVTDLVKIEGNFPDWAREAFGSIQSLNVVQSKVY
KTAFQTDDNILICAPTGAGKTNIALMTVLREIEKHINPQTKQLIDPTFKIIYISPMKALA
SEIVDKFSGMLKHMNVKCKELTGDMQLTKKEIEETQIIVTTPEKWDVFTRKKNEVAETLR
LLIIDEIHLLNDERGPVLECLVSRTLQNIERQQKSVRMLGLSATLPNYLDVASFLHVKKE
SVFFFDATYRPVPLMQRYIGVREPKQSGFKVKRKKIDIYNDLSYSISKGILEHKKQVLIF
VHSRKETIVTAQYVLKKAQDCGELHLFKPVNSDKHSLPKIKDKELQKLAPWGLGFHHAGM
LRKDRNIVEKMFNDGQIRILVATATLAWGVNLPAYGVIIKGTDVYDPSRGGTQDLSVLDI
QQMFGRAGRPQFDNNGEATLMTDINKLNSFVAQLNNASFIESRFTAHLKEALNAEIALGN
IATLKEAFDWVNYTFYSIRLRRNPMGYGCKIAQNKELSIEMHITETIENALEHLDKLRLI
RWDRQNNYLASTELGRITSHYYINCDTMNTFCKGFGISLDNDEDIEENEQKRTEYKSDLG
ILKIISQAKEFENIKMRPEETEELAVVIKKYWIFEEQIDINIKKIGTNDSTSADNNTLLI
DTPEKILALISGYLTKYQYENFSLISDSQFVIQNSIRLLRCMLDIVTKKSMASNAELVQR
WCKYIESRLVPDESPLHQFCKSNWQGYNSFKQRKEFKDGFISEDVVYKIDDREISLDTIR
EMPATELAHAINWNTRIATVIKKFVCFIPRVEVEYSVRPIAQTVLKVDVLITPKWSWSNR
WHSKSELFNLVVDDENEILHHESFTISQQQVFTSTPTEISFFVPFRDSKVPYYRLLVQHD
TWVNQPETEVQINLEHIYFQGEKMEYTELLDLHPLPISALNNSDFEQIYKMKYFNPNQTQ
IFHAMYNTDHNILIGSPTGSGKTIMSELSALRVFNLYPEKKVIYVAPLKAIAKERLADWE
VRFGKIGKTVLELTGDYTPDLDALLKADVLITTPEKWDGISRNWHNRNYVQKTGLVIFDE
IHLLGQDRGPVLEVIVSRMNMISSKTGHKVRMVGLSTAMANGTDVADWFGVPKNYFFNFR
PHVRPVPLKIYFDGFSAKAYCPRMAEMNKPAFQQIRKFGEKKPVLVFVSSRRQTRLTALD
LIAHAMHDIGGGQSPFVMCQEDELQIYLENVKDEYLKQTLSFGIGMHHAGLDQDDRKIVE
ELFLNHKVQILVATSTLAWGVNLPARLVIIKGTEYFDPKTKRYVDMPVTDILQMIGRAGR
PQFDDKGIACVFVEQSKKNFYRKYLNDPFPIESSLISQIHDHFNAEIASGTITNKQQCMD
WITWTYFFRRMLKNPTYYNLENAETKQVKKFLIELVDECMNRLAEHGCITIDDELKFNVT
PTFLGQLAAFYYIKHESVFYFEKNLTANITIPELIRVLSYCKEFEEIPLRHNEENYNEAL
SKICPLKCDKSAFSSSNEKTFLLYQVHLFRLPPPIRDYITDAKIVVDSSVRILSAMIDLV
AEKRYLNTCINLCMIMQMIMQAVWFDQSPLINVPHFDQQIVKKLGLVHFCQLIEEYKKET
LRPTLKKIDKKFGDDKLWREVEEAIKSLPDISFRARIYPFDSEKLQKQDVNLKQSEIQLT
EGGEAVVQIIIDKENEKYPNKVIVQKTGKIKDASWWVLIGDEYTGKLHALKKIFFKKNLK
KDIQIILPESFETSKKLTVFLVSDSYLGLDQVFYLNLRSKDQKADEKYQAQSDESDSDIP
KPIRQRLSDDEDDKQKKKEKPSYPKFSKGNTLKKSKAKEEENSDEEEEEKDQQKESPEKK
QDTSDQKQEDKKKNILQKKKKEGDDENSKANDSRKDDDKDFDRSKGNNLYKKKDDTQKQN
EKKESDQSNNKQERKDQPAKGGDNKDFKKKRDNRERKPKYNNDRRQQDSEDEDEYDVGYK
TKEGSHIDEFTRKRREEKNMDKLDNQNNAQNEDDEDIVQKIKEDSDFSDEEEENQRSKYR
NKRGGGGGQNFSRGSGNQGGNKYTGNQLRKKNDDDYQPRQRENDDQKKRNFQGERKFNEN
QNQGEKREYEKKPYEKKQYEKKETQFVPKEKKEPVYEPKENPSSSSQSQQQQQKSEAPKQ
QTQTKPPPTGFKLRRKNSDELNAEDKKSSNNNNNNRNNNSNNNNNNNNNRGGNNSKR


>TTHERM_01034400(gene)
ATGAGTGATAAAGATTTAGGAGAAGGTAAAAATAAGCACTTCATTACAACCTTAGTCCAC
TATGCAAATAAAGAAGTAACCATTTAAAAATCATCTTATTTTAATAGATTAATTTTACTT
AAAGCACATCAAATTGCTTTTCATTATTTTTAAATTTATTATTTTTATGGTAGAAATGCA
GATTTACTTGGAAGTTAAGGGAAAAAACGTCAGGTTACGAAAACAATGACGATAATACAG
TTAAAAGAACTAAGAATCAAAGAGAAGATTACATTAAAGTAAGAATTATTCTTTATAGAA
AGGATACATATCATTTAGATGATTAACTCTTTAATTATTCAAAATGAATATTTTCGTTTC
TACAATTTTATCAAAACCAAACTAAACAAGATTTTCTTTTCAGTTGAGAGCAAAATTATT
ATGAAATCAATTTTTTAATCAAGGCAAACATAATAGAAGGAATAAGGTTGAAAAAGTAAA
GTTTTATAAAGCAAAATGAAGTTTTTAGATTAATTGTTTGAGAGGATAAAAGTTTAGGTC
AAATCAATTTTTTTGAATTAAAGTAGAATATACTGAAATTATTTTATTAAGGATTTTAAA
TAAAATAAAAATTTGAATTCATGTCAAATTGTTAAATGAATTGATTTAAATTTAATCTTA
ATTGCGTTGATATTTGAGAAAATTCATTTAAAAGTTTTAAAATGAATTTATATTTAAAGC
TCAGATGAAAATGAATGAATATTTGATTTGGTTTTGGACAATAAAAAATAGAGTTTAATC
AATATAAATAAATTAGAATAAAAAACAATAATCATAATTTTTATTTAATTTAATAGAAAT
ATAAGGATACTTCATATGAGGACGAGTAGACTGAGATGAAATTAAGAAGAATGGATATTA
TTTATAGATTATACTACACTGAAGACGCAAAATTACGAAAATTAATGATGGATTATAAGA
CTTATGTTAAGAAGATAGGAATAGATATATAAAAGCTGGAAGAACATAGTGAATTATAGC
ATAATTTAAGATGCGTTGGCTATTATTAGGGTATTTATAAGATGTATAAGGAAGCTTAAC
TTAGACCAGATGAATGCAATCTTGTCTTTATGTAATTGATGAAGAAAGACTATGAGCCAA
AATATAAATTAGAAAACAGCGAAGAACCTTATAATTTATTATTGAGTTTGTTTTATATCA
TAGAAGATATGCAAAAGCAGATCATGGAAACTCCAATTTTTGATGAAAAGGATGAGTCTA
AGACAAAAATTATAAAAGAGTATAAGATGATTGATGAAGATTCTAAGCCTTTAGAATATG
TTGATTCTTATAATGAAAATACGCATGAAAACATTATTGAATTCAGATATGGTTATGATT
TGTTTGATGAATTCAGAAGTGATGAAATAGTTTAAATCAGATAAAAAGAAAAGCTCAATT
ATGTTAAGGAGTTCTATGAAAGATATGAAGATGTTTTGAAAAACAAATCACCTGATTTTT
GGTAGTTTTTATTGTTTGATGTTTTGAAGGCGTTGTGCAACAAAAGTAATACTGATGAAC
AATTGCAAGAAATTCTCATGAATCTTTTGGATGACTTTGATGCTTGCAGATTTTTGCTTT
CTAATAGAAAAGAAATCATCCTTTACTTGTATAAAAATCACTTCGCAAAGGATAAACAAT
TCTCATCCTCAATAAGCTCTATGAAAACTGATGACTCGCAAGGTTTGACCAACTATGAAA
TTTTGAAGTCAATTGTAAATAATTTTTAAAAATGTGTTTTGATGTTCTTATGAAAAATAA
AATAAATAGGGTATGAAAGATATAGATATCGAAAGGGAGTCTAGATTAGGATTAAAGAAA
AAAGATTTAGATTAAAAAGTTTCATAGGCTTAAAGCAAAAATTAATATGATGTTGATGAC
GAATTTTCTGAAATAGATTTTATCAAATAAGAATAAAGTTAATTAGTATAAAGAATTCCC
TCTCTTGAAAAAAGTGATTATCCAGAATACATTTAACTTAAAATATCTCCAATGCCAAGA
CATCACACTCACGTTACTGATCTTGTTAAAATCGAAGGAAATTTCCCTGATTGGGCAAGA
GTAAGAAATTACTTTTAATTTTAAATGAATAATTGAGTTAACAAAATTTTAATTTAAATT
AGGAAGCATTTGGTTCAATTTAGTCATTAAATGTAGTACAATCCAAAGTTTACAAAACTG
CCTTTTAGACAGATGATAACATTTTAATTTGCGCCCCTACTGGTGCTGGTAAAACAAACA
TCGCTTTGATGACTGTTTTAAGAGAAATAGAGAAACACATCAATCCTCAAACTAAATAGC
TTATTGATCCTACTTTTAAAATTATTTATATTTCCCCTATGAAGGCATTAGCTAGTGAAA
TAGTAGACAAATTTTCAGGAATGCTTAAACATATGAATGTTAAATGCAAAGAATTAACTG
GTGATATGCAACTCACTAAAAAGGAAATAGAAGAAACATAAATTATAGTTACTACCCCTG
AAAAATGGGATGTCTTCACACGTAAGAAAAACGAAGTTGCTGAAACTCTTCGTTTGTTAA
TTATTGATGAAATCCACTTACTTAACGACGAAAGAGGTCCTGTTTTAGAATGTTTGGTTT
CTCGTACTCTACAAAATATTGAAAGATAGTAAAAATCAGTCAGAATGCTTGGTCTTTCTG
CTACTCTTCCTAACTATTTGGATGTCGCTTCTTTCCTCCACGTTAAAAAGGAATCAGTCT
TTTTCTTCGATGCAACATACAGGTATTTTTAGTTAATAAAATCTAAACCTAATTTTTTTT
TGATTATTTTATAGACCCGTTCCTCTCATGCAAAGATATATTGGTGTTAGAGAACCAAAA
TAATCAGGCTTTAAAGTGAAAAGAAAGAAAATCGATATTTATAATGACTTGTCTTATTCT
ATTTCTAAGGGTATTTTAGAGCACAAAAAGCAAGTTTTGATTTTCGTCCATTCAAGAAAA
GAAACCATAGTTACTGCTTAATATGTATTGAAGAAAGCTCAAGATTGCGGAGAATTGCAT
TTGTTCAAGCCAGTTAATAGCGATAAGCATTCCTTACCAAAAATTAAAGACAAGGAACTA
TAAAAGTTAGCTCCTTGGGGTTTAGGTTTCCATCATGCAGGTATGTTGAGAAAAGATAGA
AATATTGTTGAAAAAATGTTTAACGATGGCCAAATTAGAATTCTCGTCGCAACAGCTACT
TTAGCTTGGGGTGTTAACTTGCCTGCTTATGGTGTTATCATTAAAGTAATTTATTTGATT
CGAAGGCAATTAAAATTTATTTAATATTAAACTAAAAGGGTACTGATGTTTACGATCCAA
GCAGAGGTGGAACTTAGGATTTGTCTGTTCTCGATATTTAATAAGTAAAGATAATTAATT
ATATGATTTAAATTGAATTTTAATTTGCTTCTTATCAAAATAGATGTTTGGTAGAGCTGG
TAGACCTTAGTTCGATAACAATGGTGAGGCAACTTTGATGACTGATATAAATAAATTGAA
CTCCTTTGTTGCTCAATTAAATAATGCAAGTTTTATTGAAAGTAGATTTACAGCACACTT
AAAGGAAGCCCTTAATGCTGAAATAGCTTTGGGAAATATAGCCACATTAAAAGAAGCATT
TGATTGGGTTAACTACACTTTTTACTCTATCAGATTGAGAAGAAATCCTATGGGTTATGG
TTGCAAGATAGCTCAAAATAAAGAACTCTCTATAGAAATGCATATAACAGAAACCATCGA
AAATGCACTTGAACATTTAGACAAGTTGAGATTGATCAGATGGGACAGATAAAATAATTA
TTTAGCATCTACAGAATTGGGTAGAATTACCTCTCACTATTATATTAATTGCGATACTAT
GAACACTTTTTGCAAAGGGTTTGGTATTTCTCTAGATAATGATGAAGACATTGAAGAAAA
TGAGTAAAAGAGAACTGAATATAAATCCGATTTAGGCATATTAAAGATTATTTCTCAAGC
TAAGGAATTTGAAAATATCAAGATGAGACCAGAAGAAACTGAAGAACTTGCTGTAGTTAT
CAAGAAATACTGGATTTTTGAAGAATAAATTGATATCAACATTAAGAAAATAGGCACAAA
CGATAGCACTTCAGCTGATAATAATACTCTTCTCATTGATACACCTGAAAAAATCTTAGC
TCTTATTTCAGGTTATCTTACCAAATATCAATACGAGAACTTTTCACTCATATCTGACTC
TTAATTCGTCATTCAAAATTCAATCCGTCTATTGAGATGTATGCTCGATATAGTCACTAA
AAAATCTATGGCTTCTAACGCAGAGCTTGTTCAAAGATGGTGTAAATACATTGAATCCAG
ACTAGTCCCAGACGAAAGTCCTCTCCATCAATTCTGTAAATCAAACTGGCAAGGATATAA
CTCATTCAAGCAAAGAAAAGAGTTCAAGGTAAAAAAATTAATTTAGATAAATTTTTATTA
AAAATAAAAAGAAAGTTCAAATATGAAAAATGAAAATATTGCAATAAATTTTAATTATTT
TTAGATTTTTATTTCCATTTAATTTAGATGAAAAGTTTATCTTATTATTCTGATAATATT
TCAAATAAAATAAAATTATATTAATTTATTTTATTCAATTTAACAGGATGGTTTCATCTC
TGAAGATGTCGTTTATAAGATTGATGACAGAGAAATAAGCTTGGATACAATAAGAGAAAT
GCCAGCTACTGAATTAGCTCATGCTATTAATTGGAATACAAGAATTGCTACTGTTATTAA
AAAGTTTGTTTGTTTCATTCCTAGAGTTGAGGTTGAATATTCTGTTCGTCCTATTGCTTA
AACAGTCCTTAAAGTAGATGTTTTAATTACACCAAAGTGGTCTTGGTCTAATAGATGGCA
TTCTAAATCTGAATTGTTCAATTTAGTTGTTGATGATGAAAATGAAATTTTACATCACGA
AAGCTTTACAATCAGCTAACAATAAGTCTTTACTTCAACTCCTACTGAAATAAGTTTCTT
CGTTCCTTTCAGAGACTCCAAGGTTCCCTATTACAGATTACTTGTTTAGCATGACACTTG
GGTCAACTAACCTGAAACTGAAGTACAAATTAATTTAGAACATATTTATTTCCAAGGTGA
GAAGATGGAATACACTGAATTGCTTGATCTCCATCCCTTACCTATTTCTGCCCTTAACAA
CTCTGATTTTGAGCAAATTTACAAAATGAAATACTTCAATCCTAATTAAACTCAAATATT
CCATGCAATGTACAACACTGACCACAACATTCTTATTGGTTCTCCCACAGGTAATATTAA
TTAATTTATTCATTAACATATTTATTGATTGAATGAAAACATTTTAATCTATATAAAAGG
TTCTGGTAAAACCATTATGTCCGAATTATCTGCCCTTAGAGTTTTCAACTTATATCCTGA
AAAGAAGGTAATGCTAGTTAGTTTATTGAATAAATTTAAAATAAAATCTAAATTTTATAA
AATAGGTTATTTATGTAGCACCCTTGAAAGCTATAGCTAAAGAAAGATTAGCAGATTGGG
AAGTTCGTTTTGGAAAAATTGGAAAAACTGTGCTAGAATTGACTGGTGATTACACTCCTG
ATTTAGATGCATTGCTCAAGGCAGATGTTTTGATTACTACACCTGAAAAGTGGGATGGTA
TTTCACGTAACTGGCACAATAGAAACTATGTCTAAAAGACAGGTTTGGTTATTTTTGATG
AAATCCATTTGCTTGGTTAAGACAGAGGACCTGTTTTAGAAGTTATTGTTTCCCGTATGA
ATATGATTTCCTCAAAAACAGGACATAAGGTTAGAATGGTTGGTCTATCTACAGCTATGG
CTAATGGTACAGATGTTGCTGATTGGTTTGGTGTTCCTAAAAATTATTTCTTCAACTTTA
GACCTCACGTTCGTCCAGTTCCTCTTAAAATCTATTTTGATGGTTTTAGGTAAAAAATTA
ATTATAATTAATTTAAATCTTTAATTTTACCTTCATAAAAAAAAGCGCAAAAGCATATTG
TCCTAGAATGGCTGAAATGAATAAGCCTGCCTTCTAACAAATCAGAAAGTTTGGTGAAAA
GAAACCCGTTCTTGTTTTTGTTTCATCAAGAAGACAAACAAGATTAACTGCTTTAGATTT
AATAGCTCATGCCATGCATGATATCGGTGGCGGATAGAGTCCTTTCGTAATGTGCTAAGA
AGACGAGCTTTAAATCTATTTAGAAAACGTTAAAGATGAATATCTTAAATAAACCCTCTC
ATTTGGTATCGGTAATGCTCACTAAAAATAAATTATAATAATTTTTATTTAAAATTAAAA
ACATACTCTTAAAATTTTTAAGATAAAAATAAAAAATATCTTTTATTTTAAATTGATTTA
AACAAAATTTTACATAAAAATGTACAAAATATCAAAAATAAAAAAGAAGTTAGATTATAT
ATTTTGAATAAATTTGTATTAAAGGGTTATTTTAAATATTAATTAGGTATGCATCATGCA
GGTTTGGATCAAGATGATAGAAAAATTGTTGAAGAATTGTTCTTGAACCACAAAGTTTAA
ATTTTAGTTGCCACTTCAACTCTAGCTTGGGGTGTTAACGTATGAATGATATTTATTTAT
TATTTATATTTTTAATATATAATTTAAAATATTAAAGCTTCCTGCTCGTTTGGTAATCAT
TAAAGGTACTGAGTATTTTGATCCTAAGACAAAGAGATATGTAGACATGCCTGTTACTGA
TATTTTATAGATGATTGGTCGTGCTGGTCGTCCACAATTCGATGATAAAGGTATTGCTTG
TGTTTTTGTTGAGTAAAGCAAAAAGAATTTCTATAGAAAATACTTGAATGATCCTTTCCC
TATCGAATCATCTCTTATCAGCCAAATCCATGACCACTTTAATGCAGAAATAGCTAGTGG
TACTATTACTAACAAACAATAATGCATGGATTGGATTACATGGACATATTTCTTCAGACG
TATGCTTAAAAATCCTACTTATTACAATTTAGAAAACGCAGAAACCAAGCAAGTTAAAAA
GTTCTTAATTGAGTTGGTCGATGAATGTATGAACAGACTAGCTGAACATGGTTGCATAAC
CATTGATGACGAATTAAAATTCAATGTTACTCCAACTTTCTTAGGTTAGCTTGCTGCTTT
CTACTATATTAAGCACGAATCAGTTTTCTACTTTGAAAAAAATCTAACTGCTAATATTAC
TATCCCAGAACTTATCAGAGTTCTTTCATACTGCAAAGAATTCGAAGAAATTCCTCTCCG
TCACAACGAAGAAAATTACAATGAAGCTCTCTCTAAGATTTGTCCTCTTAAGTGTGATAA
GAGTGCTTTCAGTTCTTCAAATGAAAAAACTTTCCTTCTTTATTAAGTAAATTTTATTAT
TTTATTTCACTCAAAAAATAACTCAAATAAATTTAATTTTGTTTTTTAACATTGTTTACA
TAATAAAATTTATCAATTAATTAGGTTCACTTATTTAGATTACCTCCTCCTATTAGAGAT
TACATTACTGATGCAAAGATCGTTGTTGATAGTTCTGTTCGTATTTTGAGTGCCATGATC
GACTTAGTAGCTGAAAAGAGATACTTGAATACATGCATTAATTTATGTATGATCATGCAA
ATGATTATGCAAGCTGTTTGGTTTGATTAGAGTCCATTAATCAATGTTCCTCACTTCGAC
TAGCAGATTGTGAAGAAATTGGGATTGGTCCACTTCTGTCAATTAATAGAAGAATATAAA
AAGGAAACTCTTCGTCCTACTCTAAAGAAGATAGATAAGAAATTCGGTGATGATAAACTC
TGGAGAGAAGTCGAAGAAGCTATCAAATCACTACCAGATATTTCCTTTAGGGCCAGAATT
TATCCTTTCGACTCTGAAAAATTGCAAAAGCAAGATGTTAACTTGAAACAATGTAATTTA
TCTAATTAAATAATTAAAAAAAACATTTCCATTTATTAATAAAATAAAGCTGAAATTTAA
CTCACTGAAGGAGGTGAAGCAGTGGTTTAAATTATTATTGATAAGGAGAATGAAAAATAT
CCCAATAAGGTGATTGTTTAGAAGACAGGAAAAATTAAAGTATGAATTTTATAAATATAA
ATAGAATTTAAGTTTAAAAATAATTATTATATTTAGGATGCATCTTGGTGGGTTTTAATT
GGTGATGAATACACAGGCAAGCTTCATGCTTTGAAGAAAATATTCTTCAAAAAGAATTTA
AAGAAGGATATTCAAATTATTTTACCTGAGAGCTTCGAAACTAGCAAAAAGCTGACTGTT
TTCTTGGTTTCTGATTCATATCTTGGATTAGATTAAGTTTTCTATTTAAATTTAAGAAGC
AAAGACTAAAAAGCTGATGAAAAATATTAAGCCTAAAGCGATGAATCAGATAGTGACATT
CCAAAGCCAATTAGATAGAGACTTAGTGATGATGAAGATGACAAACAAAAGAAGAAAGAA
AAGCCTTCTTATCCTAAATTCTCTAAAGGCAACACATTAAAGAAGAGCAAGGCAAAAGAA
GAAGAAAATAGCGATGAAGAAGAAGAAGAAAAAGATTAATAAAAAGAAAGTCCTGAAAAG
AAACAAGATACTAGTGACTAAAAGCAAGAAGATAAAAAGAAAAATATTCTTTAGAAAAAG
AAAAAAGAAGGAGATGATGAAAATAGTAAAGCTAACGATAGCAGGAAAGATGATGATAAA
GACTTTGATAGAAGCAAAGGAAATAACCTATATAAAAAGAAAGATGACACTTAAAAGTAA
AACGAAAAGAAAGAGTCTGACTAAAGTAACAATAAATAAGAGAGAAAGGATCAACCTGCT
AAAGGAGGAGATAATAAAGATTTTAAAAAGAAAAGGGATAACAGAGAACGTAAGCCTAAA
TACAACAATGATAGAAGACAATAAGATTCTGAAGATGAAGATGAATATGATGTAGGCTAT
AAGACTAAAGAGGGCTCTCACATCGATGAATTCACTCGTAAAAGAAGAGAAGAAAAGAAT
ATGGATAAACTTGATAACTAAAATAATGCTCAGAATGAAGATGACGAAGATATAGTTTAA
AAAATAAAAGAAGATAGTGACTTTAGTGATGAAGAAGAAGAAAACCAAAGATCAAAATAC
AGAAATAAAAGAGGTGGCGGTGGTGGATAAAACTTTAGTCGCGGTAGTGGTAACTAAGGT
GGTAATAAATACACTGGAAATTAATTAAGAAAGAAAAATGATGACGATTACTAACCCAGA
CAAAGAGAAAATGATGATTAAAAAAAGAGAAATTTCTAAGGCGAGAGAAAGTTCAATGAA
AATTAAAATTAAGGAGAAAAGCGTGAATATGAGAAGAAGCCCTACGAAAAGAAGCAATAT
GAAAAGAAAGAAACTCAATTCGTGCCAAAAGAAAAGAAAGAACCTGTTTATGAACCCAAA
GAAAATCCATCCTCTTCTTCTTAATCCTAACAATAGTAATAAAAATCAGAGGCTCCAAAA
CAACAAACTCAAACTAAGCCACCACCAACTGGTTTTAAACTAAGACGTAAAAATAGCGAC
GAATTAAATGCAGAAGATAAAAAGAGTTCAAACAATAACAATAATAATAGAAATAATAAT
AGTAATAATAACAACAACAATAATAATAACAGAGGTGGCAATAACTCTAAGCGTTGA