Identifiers and Description

Gene Model Identifier

TTHERM_00628520

Standard Name

DRH31 (DExD/H box RNA helicase 31)

Aliases

PreTt24678 | 88.m00146 | 3822.m00666

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00628520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17275.19.997093137033517e-262DEAD/DEAH box helicase (1412 a
a)
SGDYLR398C1.999126889527329e-167SKI2 Ski complex component and
putative RNA helicase, mediat
es 3-5 RNA degradation by the
cytoplasmic exosome; null muta
nts have superkiller phenotype
of increased viral dsRNAs and
are synthetic lethal with mut
ations in 5-3 mRNA decay
OxytrichaContig21835.0.g971.999765224767555e-159DSHCT (NUC185) domain
WormBaseWBGene000085024.0008150871967356e-141locus:skih-2 status:Partiall
y_confirmed UniProt:Q19103
protein_id:CAA92767.2
DictyBaseDDB_G02756338.001645293484705e-131DDB_G0275633 on chromosome: 2
position 5972320 to 5975825
Stentor CoeruleusSteCoe_79175.814040485895939e-62

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00628520(coding)
ATGAATGGATAAGAAGATTAACTACTTTAGGCATTTGACTGGTTAATATATGCTAACTAA
AGCAGAATTCCAAAAATATTAGATTTTGAATAACAGTTATTTTAGTTCGATGTGAAAGAC
CAAGCTCTCCCTAGTCATTTTTAGGTTGTGATTAATAATCCAGAAAGATAAAATACATAA
TTATATCTCAATAATCATTTCACTAGCGTTCACTATGAAGAATCTTTTGCAGATTTAAAA
TATATTAAAAAAGGGTAATTAGAACGAAGAATTTTAAAAGATATTTATGAGCATGATGTA
GATTTAATGGGTTTTTAATTCGATTAAAATTAAGTTGAATCTGAAATGTTAGATATAGGC
TATAAGCGCGCATTAGATGAAGTAGATTTACACTTAAAAAATCCTTTTACAACAACTTTT
AGCTATGATTATATGGATAACGAATTTACAGGATTTTAAGACTAAATGGTGTAGAATAAT
TCATTTAAGAATTATTCAACAGATCAATCTTAAGATAATACACAACAACAATAAAAAGGC
TAGTAATTATTAAACGAATATTACAATCAAGGTAATGCAAGCTAAGAAATAAATGCTTAA
TAAGTTTAAGGTTATTAATCGCAAAATAATATAGTTGAGGACTTTTAAGTCTTGGGAAAT
CAGGTAGAATAATACTTAGCTGAACTAAGATAAAAATAGCAAAGCATTAAAAATAGAATT
AATATTCCTTAGCTTTCACTAGAAGATCTCATTAAAGTGAATAAATTTAGCAGAGTCCTT
TCTATTTTCTAAAAAGCAGGTTAAAAAGAAGCAAAAAAGCACAAAGTTATTTAAAAATCT
ACTGTAGACATGGACCCAGAAGAGATTTTCAAACAATTAAAAAGTGAGTGGGTAGAAGAA
TAAAAAGAAGAGGAAGAATTAAAATAATCTTATGAGCTGTAAATTTTAGCAAATTTAGAT
TTTGATGTTATGATAGACAAAGTAGAAGAAAAAATACAATTTGAGGAATAGCAACTACTT
GAAAAGGTCAAAAAGATGTAGGAAGAATTAAAATCTCAAAGCTTCGAGATGCAAGAAGAC
CAAATTTATTCTCTAGGATAGCAAAATAAAATGGAATAATTTAATAAAATTAAATTGGTG
GATACTTAAGAAATCAATGAAAAAAAATTATAATTGTCTTCATCTTACGATTGGGCAGTC
GAAGATCAGTTTAATTTAGCTAAATTTTATGAGGAAGTACCCAAAGAAAAAATGGCGTAA
TAATATCCTTTTGAGCTCGATGCTTTCCAAAAGAGGTCAGTTTACAGAATAGAAAGAAAA
GAAAGTGTTTTTGTTTGTGCTCATACATCTGCAGGTAAAACAGTAGTTGCTGAATACGCA
ATAGCTATTTCTAAAAAGCTTAATAGAAAAGCAATTTATACTTCTCCTATTAAAGCTTTA
TCAAACCAAAAGTATAGAGATTTTAAGTAAAAATACGGTGATGATGTAGGTCTAGTTACT
GGTGATGTGTAACTCAACCCCAATGCAAATTGTTTAATTGTAACAACAGAAATTTTGAGA
AATATGCTCTACAGAAACAACGATATAATTAGAGATATTGAATGGGTTATATTTGATGAA
GTTCATTATTTAAATAATCCTGAGAGAGGTCTGGTTTGGGAAGAAACAATTATTATGCTT
CCTGAGACAGTCGGTTTTGTAATGCTCAGTGCAACAGTTCCGAATTACATGGAATTCGCT
AATTGGGTAGGAAGAACTAAAAAAAGAAAAATTTATGTATAAAAAACTGATTTTAGACCT
GTTCCCTTAGAACATTCTATTTATTTAAATGGCTCAATAGAAGTAATTAAGCAAGGAGAC
AATCGTTTTAATGCCACTGATTATGACTAATTTAAGAACAGAATTATAAAAACATACATG
AATCAGAAGAATTAATTAACTGCATAAAAGAAATCATTAAAGCTTGAAAAGTATCAAAAA
GGAATTCTAAAAAATACAAATACATCGATGAGAAACAAAAGAACAATGAAAGCAATCACT
GAAAAATTCATTAAATCCACTGATGAAGACGATTACAATTCTTCAAGCAGTACAAACGAA
GGATTTAATTTGATGTAACTCCTAATTAAATGCTAAAATGAAAACTTACTACCCTGTGTT
ATTTTCTGCTTTTCTAAAAGGAAAATAGACGAAATAGCAAATTAAATTAAATAACTTAAC
TTTTGTGATTATGAGGAAACTGTAAGAATAGAATATTATTTCAGGTAGTGTTCCAGAAAG
ATTAAGTCAAGAGATTTAAATGTGCCTTAAATACAAACCATTAAAGATTTACTTCTTAGA
GGTATAGGTATCCATCATGGTGATGTTATTCCTTTCATGAAAGAAGTTGTTGAAATTCTT
TTCTCACAAAGCCTTATAAAAGTTCTAATTGCTACAGAAACATTTGCTATGGGTATTAAT
ATGCCTACAAAAACAGTTATTTTCCACTCTCTTAAAAAGTTTGACTCTTCTGGTGAAAGA
CTGCTGAATTCATCAGAATTTACTTAAATGAGTGGTAGAGCAGGTAGAAGAGGTTTAGAT
GTAAAGGGAAATGTTATAATTTTTGTTAATTCAATTGAGTAGCTTCCATCTAAAAATGAC
TTAAATATCATAATGGACACTAAGGGATAATATTTGGAATCTAAATTTAAAATCACATAT
GAAACAATCATCAACTTGCTTAATTCTAATGTACTTAATGTAATTGATATGATGAAGAAA
AGTTATTAAGAGAATCACAAATATGCTTAGTTACCAAACAATATCAAGAAAATAAAAGAA
CTTAAATTAAAATATTTAGAATTAAAGAATATGAAATGCAAATTACAACCTCCAGGAATC
GATGAACTTCCTATTGAGAAATACATATAAAGTTCTTAAATTATGAGATAATTAAATAAA
AACTATTTCTAACAAGTAAAAACATACATGGTAGAAAAGATGGAGCTTCCTTCTTACTGT
GTCATGTACGATGACGTTTACAAATTCTATTTTGGGATGATTATTTATATCAATCTTAAA
GATAAATACGAAGACAGATTCCTATATGTTTTATATGTAGATAGTATTGATGTCCAACAA
GGACCTATTTTTAATTTCCAAGAAGATGCATTCCACTCACATGTTGTCGAAAATCACCAT
TACTGTGATGAATCTAACGACTACAAAGAATATACTTACAAAATATTTAAGCTGCCCGTT
TCTTGCATTTGTAAGATATACGAAGATGACCCTGGAATTGAAGATGGAGAATTAGAAGAT
TAAGAATATGTTTAATCATGCGTTAAGTTGCTTATTTCTAAAAAAAATTAATTTAAAGAG
GTTTTTCTATCTGAAGAAATCTCATCTAAAAAAATGAAGAGGAAAAAATTCTTGGATATG
AAATTCTAAAACACAACTGACATATCAAAATCTGCACTAAATAATAATTTAGACTCAATA
TAAACTTCACTTTGTCATTAATGTGATATCAAAGATTTGCATATTAGCCAAGTCTTCGAA
AGAAAGTAAATTAAAACTGATCTAGAAGAACTTATTAAAAAAGTAGATGAAAATGACTTA
AATCAAAGAACAAGTTTTGAAAGTAAATTGAAGATTTTGAAAAGATTTGGTTATGTTGAT
TTAGTTAACAAACCTACTTTTAAGGCTCGTATAGCTAAAGAAATACAAAATATTTATGTC
ACAGAGGTAATATTCTAAGAATCTCTTGAATCTTTAGAAGAATGTGACATAGCAGCTCTT
CTAAGTGGTTTTGTATGTTAAGCTAAATCTAAAAGTGCAGTTAAATATGACCCAATAGAT
GACTTTAGCCCTTTCTATCCTAATTATGATAATTTTATGGAATCTTATCTAGAAATTATA
TAATCTGTCAAGGCTGTTATCTCTTACGAATGTTAATTCGGAGTTATTCAATGTGGTAAT
GAAGATGACTATATGTTTGATCAAGTTTATATAAGAGACTTAATTGAAGTTGTATACTAA
TGGATGAATGGAATGGATTTCTAAAATATTTGCGAAATGACATCTATATAAGAAGGTGCT
ATAGTAAGAAGCTTCCTTAGACTTGAAAATTTACTCAAAAATGTAAGAAATGGTTATATT
ATTATGGGAAATTATGCAATGGGAGTTAAACTAGACAGATGCATGGAAATGCTCAAGAAA
GATATAATTTTTTCTAAAAGTTTGTATTTAGACTAAGACGATCATTGA


>TTHERM_00628520(protein)
MNGQEDQLLQAFDWLIYANQSRIPKILDFEQQLFQFDVKDQALPSHFQVVINNPERQNTQ
LYLNNHFTSVHYEESFADLKYIKKGQLERRILKDIYEHDVDLMGFQFDQNQVESEMLDIG
YKRALDEVDLHLKNPFTTTFSYDYMDNEFTGFQDQMVQNNSFKNYSTDQSQDNTQQQQKG
QQLLNEYYNQGNASQEINAQQVQGYQSQNNIVEDFQVLGNQVEQYLAELRQKQQSIKNRI
NIPQLSLEDLIKVNKFSRVLSIFQKAGQKEAKKHKVIQKSTVDMDPEEIFKQLKSEWVEE
QKEEEELKQSYELQILANLDFDVMIDKVEEKIQFEEQQLLEKVKKMQEELKSQSFEMQED
QIYSLGQQNKMEQFNKIKLVDTQEINEKKLQLSSSYDWAVEDQFNLAKFYEEVPKEKMAQ
QYPFELDAFQKRSVYRIERKESVFVCAHTSAGKTVVAEYAIAISKKLNRKAIYTSPIKAL
SNQKYRDFKQKYGDDVGLVTGDVQLNPNANCLIVTTEILRNMLYRNNDIIRDIEWVIFDE
VHYLNNPERGLVWEETIIMLPETVGFVMLSATVPNYMEFANWVGRTKKRKIYVQKTDFRP
VPLEHSIYLNGSIEVIKQGDNRFNATDYDQFKNRIIKTYMNQKNQLTAQKKSLKLEKYQK
GILKNTNTSMRNKRTMKAITEKFIKSTDEDDYNSSSSTNEGFNLMQLLIKCQNENLLPCV
IFCFSKRKIDEIANQIKQLNFCDYEETVRIEYYFRQCSRKIKSRDLNVPQIQTIKDLLLR
GIGIHHGDVIPFMKEVVEILFSQSLIKVLIATETFAMGINMPTKTVIFHSLKKFDSSGER
LLNSSEFTQMSGRAGRRGLDVKGNVIIFVNSIEQLPSKNDLNIIMDTKGQYLESKFKITY
ETIINLLNSNVLNVIDMMKKSYQENHKYAQLPNNIKKIKELKLKYLELKNMKCKLQPPGI
DELPIEKYIQSSQIMRQLNKNYFQQVKTYMVEKMELPSYCVMYDDVYKFYFGMIIYINLK
DKYEDRFLYVLYVDSIDVQQGPIFNFQEDAFHSHVVENHHYCDESNDYKEYTYKIFKLPV
SCICKIYEDDPGIEDGELEDQEYVQSCVKLLISKKNQFKEVFLSEEISSKKMKRKKFLDM
KFQNTTDISKSALNNNLDSIQTSLCHQCDIKDLHISQVFERKQIKTDLEELIKKVDENDL
NQRTSFESKLKILKRFGYVDLVNKPTFKARIAKEIQNIYVTEVIFQESLESLEECDIAAL
LSGFVCQAKSKSAVKYDPIDDFSPFYPNYDNFMESYLEIIQSVKAVISYECQFGVIQCGN
EDDYMFDQVYIRDLIEVVYQWMNGMDFQNICEMTSIQEGAIVRSFLRLENLLKNVRNGYI
IMGNYAMGVKLDRCMEMLKKDIIFSKSLYLDQDDH


>TTHERM_00628520(gene)
ATGAATGGATAAGAAGATTAACTACTTTAGGCATTTGACTGGTTAATATATGCTAACTAA
AGCAGAATTCCAAAAATATTAGATTTTGAATAACAGTTATTTTAGTTCGATGTGAAAGAC
CAAGCTCTCCCTAGTCATTTTTAGGTTGTGATTAATAATCCAGAAAGATAAAATACATAA
TTATATCTCAATAATCATTTCACTAGCGTTCACTATGAAGAATCTTTTGCAGATTTAAAA
TATATTAAAGTAATTTATTCAATTTATCAAAATTTAATGTTAAATGTTCAATATTTTTTT
ATAGAAAGGGTAATTAGAACGAAGAATTTTAAAAGATATTTATGAGCATGATGTAGATTT
AATGGGTTTTTAATTCGATTAAAATTAAGTTGAATCTGAAATGTTAGATATAGGCTATAA
GCGCGCATTAGATGAAGTAGATTTACACTTAAAAAATCCTTTTACAACAACTTTTAGCTA
TGATTATATGGATAACGAATTTACAGGATTTTAAGACTAAATGGTGTAGAATAATTCATT
TAAGAATTATTCAACAGATCAATCTTAAGATAATACACAACAACAATAAAAAGGCTAGTA
ATTATTAAACGAATATTACAATCAAGGTAATGCAAGCTAAGAAATAAATGCTTAATAAGT
TTAAGGTTATTAATCGCAAAATAATATAGTTGAGGACTTTTAAGTCTTGGGAAATCAGGT
AGAATAATACTTAGCTGAACTAAGATAAAAATAGCAAAGCATTAAAAATAGAATTAATAT
TCCTTAGCTTTCACTAGAAGATCTCATTAAAGTGAATAAATTTAGCAGAGTCCTTTCTAT
TTTCTAAAAAGCAGGTTAAAAAGAAGCAAAAAAGCACAAAGTTATTTAAAAATCTACTGT
AGACATGGACCCAGAAGAGATTTTCAAACAATTAAAAAGTGAGTGGGTAGAAGAATAAAA
AGAAGAGGAAGAATTAAAATAATCTTATGAGCTGTAAATTTTAGCAAATTTAGATTTTGA
TGTTATGATAGACAAAGTAGAAGAAAAAATACAATTTGAGGAATAGCAACTACTTGAAAA
GGTCAAAAAGATGTAGGAAGAATTAAAATCTCAAAGCTTCGAGATGCAAGAAGACCAAAT
TTATTCTCTAGGATAGCAAAATAAAATGGAATAATTTAATAAAATTAAGTAAAATCTATA
AAATATTTTTTTCATTTTCATTAAATTAAAAAATAAGATTTATTTAAATGCAAATTTAAA
TGAAATATTTTAAAAATAGATTGGTGGATACTTAAGAAATCAATGAAAAAAAATTATAAT
TGTCTTCATCTTACGATTGGGCAGTCGAAGATCAGTTTAATTTAGCTAAATTTTATGAGG
AAGTACCCAAAGAAAAAATGGCGTAATAATATCCTTTTGAGCTCGATGCTTTCCAAAAGA
GGTCAGTTTACAGAATAGAAAGAAAAGAAAGTGTTTTTGTTTGTGCTCATACATCTGCAG
GTAAAACAGTAGTTGCTGAATACGCAATAGCTATTTCTAAAAAGCTTAATAGAAAAGCAA
TTTATACTTCTCCTATTAAAGCTTTATCAAACCAAAAGTATAGAGATTTTAAGTAAAAAT
ACGGTGATGATGTAGGTCTAGTTACTGGTGATGTGTAACTCAACCCCAATGCAAATTGTT
TAATTGTAACAACAGAAATTTTGAGAAATATGCTCTACAGAAACAACGATATAATTAGAG
ATATTGAATGGTAAACAATTTATTTATTTTTCTTAAACGTTATGTTTTCATTGTTTATTT
ACAAAACACTGTCATTATTTCATTAAATTTAGTTAGCTAATAATTATATTTTTATATTTT
ATAGGGTTATATTTGATGAAGTTCATTATTTAAATAATCCTGAGAGAGGTCTGGTTTGGG
AAGAAACAATTATTATGCTTCCTGAGACAGTCGGTTTTGTAATGCTCAGTGCAACAGTTC
CGAATTACATGGAATTCGCTAATTGGGTAGGAAGAACTAAAAAAAGAAAAATTTATGTAT
AAAAAACTGATTTTAGACCTGTTCCCTTAGAACATTCTATTTATTTAAATGGCTCAATAG
AAGTAATTAAGCAAGGAGACAATCGTTTTAATGCCACTGATTATGACTAATTTAAGAACA
GAATTATAAAAACATACATGAATCAGAAGAATTAATTAACTGCATAAAAGAAATCATTAA
AGCTTGAAAAGTATCAAAAAGGAATTCTAAAAAATACAAATACATCGATGAGAAACAAAA
GAACAATGAAAGCAATCACTGAAAAATTCATTAAATCCACTGATGAAGACGATTACAATT
CTTCAAGCAGTACAAACGAAGGATTTAATTTGATGTAACTCCTAATTAAATGCTAAAATG
AAAACTTACTACCCTGTGTTATTTTCTGCTTTTCTAAAAGGAAAATAGACGAAATAGCAA
ATTAAATTAAATAACTTAACTTTTGTGATTATGAGGAAACTGTAAATAAATATCAATTAA
TTTAAAGCAACTTTTTTAGATTATTTTATATAAAAATAATTAAAGGTAAGAATAGAATAT
TATTTCAGGTAGTGTTCCAGAAAGATTAAGTCAAGAGATTTAAATGTGCCTTAAATACAA
ACCATTAAAGATTTACTTCTTAGAGGTATAGGTATCCATCATGGTGATGTTATTCCTTTC
ATGAAAGAAGTTGTTGAAATTCTTTTCTCACAAAGCCTTATAAAAGTTCTAATTGCTACA
GAAACATTTGCTATGGGTATTAATATGCCTACAAAAACAGGTAAAGACTTTACTAACTTC
ATTTCAAAATTTATTTATTTTTTTAATTTAAAAATTTCATTTTATTTTCTTAAAACTGGA
TTAATTTTTAAAATAAATAAACTCAGAAAAAAAGTTTAATATCAATTTTTTTGTTATTCA
AAGAAATATTTTTTATTTTCATATTTTAAGATCAAATTGTAAGTGAATAAATAATTTCAG
ATTAAATAAATTTATTTGTTTTATGTTTTGCTAAATATTTTTTTTCTTTAAATTTTGGAT
GGATTGAAAAAAAAATTCAAATTTAAAAAATAACTAAAAATATTTGTTAATTTTAATTAA
AAGTTATTTTCCACTCTCTTAAAAAGTTTGACTCTTCTGGTGAAAGACTGCTGAATTCAT
CAGAATTTACTTAAATGAGTGGTAGAGCAGGTAGAAGAGGTTTAGATGTAAAGGGAAATG
TTATAATTTTTGTTAATTCAATTGAGTAGCTTCCATCTAAAAATGACTTAAATATCATAA
TGGACACTAAGGTAAATAAATAAATAATTAGTATTCGATTAATATTAAATTTAAATAATA
TTTTTTATAGGGATAATATTTGGAATCTAAATTTAAAATCACATATGAAACAATCATCAA
CTTGCTTAATTCTAATGTACTTAATGTAATTGATATGATGAAGAAAAGTTATTAAGAGAA
TCACAAATATGCTTAGTTACCAAACAATATCAAGAAAATAAAAGAACTTAAATTAAAATA
TTTAGAATTAAAGAATATGAAATGCAAATTACAACCTCCAGGAATCGATGAACTTCCTAT
TGAGAAATACATATAAAGTTCTTAAATTATGAGATAATTAAATAAAAACTATTTCTAACA
AGTAAAAACATACATGGTAGAAAAGATGGAGCTTCCTTCTTACTGTGTCATGTACGATGA
CGTTTACAAATTCTATTTTGGGATGATTATTTATATCAATCTTAAAGATAAATACGAAGA
CAGATTCCTATATGTTTTATATGTAGATAGTATTGATGTCCAACAAGGACCTATTTTTAA
TTTCCAAGAAGATGCATTCCACTCACATGTTGTCGAAAATCACCATTACTGTGATGAATC
TAACGACTACAAAGAATATACTTACAAAATATTTAAGCTGCCCGTTTCTTGCATTTGTAA
GATATACGAAGATGACCCTGGAATTGAAGATGGAGAATTAGAAGATTAAGAATATGTTTA
ATCATGCGTTAAGTTGCTTATTTCTAAAAAAAATTAATTTAAAGAGGTTTTTCTATCTGA
AGAAATCTCATCTGTAAATTTGTTCAAATATCTTTAATTTATTTATTTATTTCTTTATTT
TAATTTTGTTTAGAAAAAAATGAAGAGGAAAAAATTCTTGGATATGAAATTCTAAAACAC
AACTGACATATCAAAATCTGCACTAAATAATAATTTAGACTCAATATAAACTTCACTTTG
TCATTAATGTGATATCAAAGATTTGCATATTAGCCAAGTCTTCGAAAGAAAGTAAATTAA
AACTGATCTAGAAGAACTTATTAAAAAAGTAGATGAAAATGACTTAAATCAAAGAACAAG
TTTTGAAAGGTAGATTTTATTTTTACTTTTATTATTTATTTTGAAAGTTTAAAATAATTA
TTTTGCAATTAGTAAATTGAAGATTTTGAAAAGATTTGGTTATGTTGATTTAGTTAACAA
ACCTACTTTTAAGGCTCGTATAGCTAAAGAAATACAAAATATTTATGTCACAGAGGTAAT
ATTCTAAGAATCTCTTGAATCTTTAGAAGAATGTGACATAGCAGCTCTTCTAAGTGGTTT
TGTATGTTAAGCTAAATCTAAAAGTGCAGTTAAATATGACCCAATAGATGACTTTAGCCC
TTTCTATCCTAATTATGATAATTTTATGGAATCTTATCTAGAAATTATATAATCTGTCAA
GGCTGTTATCTCTTACGAATGTTAATTCGGAGTAAATTATAAATAAATAAATAAAGAGTA
AGTTTCTTAACATATTTAATTTTATTTTAGGTTATTCAATGTGGTAATGAAGATGACTAT
ATGTTTGATCAAGTTTATATAAGAGACTTAATTGAAGTTGTATACTAATGGATGAATGGA
ATGGATTTCTAAAATATTTGCGAAATGACATCTATATAAGAAGGTGCTATAGTAAGAAGC
TTCCTTAGACTTGAAAATTTACTCAAAAATGTAAGAAATGGTTATATTATTATGGGAAAT
TATGCAATGGGAGTTAAACTAGACAGATGCATGGAAATGCTCAAGAAAGATATAATTTTT
TCTAAAAGTTTGTATTTAGACTAAGACGATCATTGA