Identifiers and Description

Gene Model Identifier

TTHERM_01126400

Standard Name

DRH29 (DExD/H box RNA helicase 29)

Aliases

PreTt01699 | 246.m00028

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_01126400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03132.19.997093137033517e-262DEAD/DEAH box helicase (452 aa
)
WormBaseWBGene000115805.998633383648922e-18locus:ddx-19 status:Confirme
d UniProt:B7WN81 protein_i
d:CAT01056.1
DictyBaseDDB_G02691924.0002685161515803e-16tifA on chromosome: 1 position
3537960 to 3539386
SGDYOR046C4.0002685161515803e-16DBP5 Cytoplasmic ATP-dependent
RNA helicase of the DEAD-box
family; involved in mRNA expor
t from the nucleus; involved i
n translation termination; ATP
/ADP cycling is regulated by G
le1p and Nup159p
OxytrichaContig2122.0.g989.997764199084386e-16DEAD/DEAH box helicase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01126400(coding)
ATGGCTGATATTAAGATTGAGACAGATTTAAAGGACAGAATGAAAAATGTGAAGCAATGG
TTTCACAAAGTTAAATCAGATCAAGAAAAGAGAGACTTCATCTTCGATTTTATTAAGAAA
TTGATTGAAGACACTGATGCTTAGCCAAAAGTAGTTATCTTCTTTAATGAAAAGAAGTAT
CTATTAGACTTTTTCTCAGTATTAAAATCCGATAAGCGCTTTAGTGATATGAATGACAAA
TTTAATATTATCCATGGTGATTAGGATATAAAAGAAAGAAAGTTGATTCGTCGTAAATTT
GATGATGGTGAATTTAATTATCTCTTAACAACTAACTTGGTTGCAAGAGGTATTGACTTC
AACGAAGTTACATCAGTAATCAATTGCGATATTCCTGTAGATATAAAAAAGAAGAGCAAT
GACGAAAATAGACCCGTTAAGCCTGATGAAATAGATGTCTAAACTTATATTCATAGAGTA
GGTAGAGCAGGTCGTTCTAATAAGAAGGGTGTAGCCATTTCAGTTTCAAACATAGAAGGA
GAAGAAGCTGTTATCGATCTAGCTAAAAAACTTGATGTTACTATTATAAAATATGAAGAT
TTTGAGCAAATAAAAAATCATCTTGCAGAATGCTATAAGCACAACAAAGAATAAAATGAA
CTCTTCAAAACTTTAGTTTCAGAGAAATCTTGGAAAGATATAGGAATTAGCGATGAATTT
TAAACCTAGCTTTTTAATAATGGCTTTAAATACCCTAAACCTTCATAAGTTATTTGTGTT
CCTAAAATTCTCAATTACTAAGTTGATAAAGCTAAATTTTATAAGCACATCTCTGTATAC
GGTTTCGCAAACGGCAGAGGTAAAACTCTTTGCTTCCTCACCCCAATGATTGAAAAATTT
AAAAGCTAAGAACCAATGAGCAAGCCTTGGTGTCCTCAAGCAATTATAATGGCTCACACA
AAGGATCTTTGTTTGCAAATTGGTAAACAAATAGCTGCTATTATGCCTCCAAGCAAAAAG
TATGAGATATCTTATCTCTTTAGAGACACTGATACCAAAGATATTAAGGGTTCTATTTGC
ATTGGCACTCCTGGTTATATCTAGAAAATATTAAACAGCATTAAAACTAAAGACCTAAAG
TTCTTAATTATTGACGAAGCTGATGAAGTCTTGGATTCTAACAAGAATGAGCTTAGGGAT
ACTCTAAACAAAATTTACGATGACATTAGTGAAGGTTTCTAGCTTATTTTGTTCTCAGCA
ACTTTTGAAGAAAGCGACATCGCAAATCTTGAAGAAATTATTGATGATGACGATTTTAAT
AAGGATGACATTAACTTTGAAGCTTTCTTTTAGATTTGA


>TTHERM_01126400(protein)
MADIKIETDLKDRMKNVKQWFHKVKSDQEKRDFIFDFIKKLIEDTDAQPKVVIFFNEKKY
LLDFFSVLKSDKRFSDMNDKFNIIHGDQDIKERKLIRRKFDDGEFNYLLTTNLVARGIDF
NEVTSVINCDIPVDIKKKSNDENRPVKPDEIDVQTYIHRVGRAGRSNKKGVAISVSNIEG
EEAVIDLAKKLDVTIIKYEDFEQIKNHLAECYKHNKEQNELFKTLVSEKSWKDIGISDEF
QTQLFNNGFKYPKPSQVICVPKILNYQVDKAKFYKHISVYGFANGRGKTLCFLTPMIEKF
KSQEPMSKPWCPQAIIMAHTKDLCLQIGKQIAAIMPPSKKYEISYLFRDTDTKDIKGSIC
IGTPGYIQKILNSIKTKDLKFLIIDEADEVLDSNKNELRDTLNKIYDDISEGFQLILFSA
TFEESDIANLEEIIDDDDFNKDDINFEAFFQI


>TTHERM_01126400(gene)
ATGGCTGATATTAAGATTGAGACAGATTTAAAGGACAGAATGAAAAATGTGAAGCAATGG
TTTCACAAAGTTAAATCAGATCAAGAAAAGAGAGACTTCATCTTCGATTTTATTAAGAAA
TTGATTGAAGACACTGATGCTTAGCCAAAAGTAGTTATCTTCTTTAATGAAAAGAAGTAT
CTATTAGACTTTTTCTCAGTATTAAAATCCGATAAGCGCTTTAGTGATATGAATGACAAA
TTTAATATTATCCATGGTGATTAGGATATAAAAGAAAGAAAGTTGATTCGTCGTAAATTT
GATGATGGTGAATTTAATTATCTCTTAACAACTAACTTGGTTGCAAGAGGTATTGACTTC
AACGAAGTTACATCAGTAATCAATTGCGATATTCCTGTAGATATAAAAAAGAAGAGCAAT
GACGAAAATAGACCCGTTAAGCCTGATGAAATAGATGTCTAAACTTATATTCATAGAGTA
GGTAGAGCAGGTCGTTCTAATAAGAAGGGTGTAGCCATTTCAGTTTCAAACATAGAAGGA
GAAGAAGCTGTTATCGATCTAGCTAAAAAACTTGATGTTACTATTATAAAATATGAAGAT
TTTGAGCAAATAAAAAATCATCTTGCAGAATGCTATAAGCACAACAAAGAATAAAATGAA
CTCTTCAAAACTTTAGTTTCAGAGAAATCTTGGAAAGATATAGGAATTAGCGATGAATTT
TAAACCTAGCTTTTTAATAATGGCTTTAAATACCCTAAACCTTCATAAGTTATTTGTGTT
CCTAAAATTCTCAATTACTAAGTTGATAAAGCTAAATTTTATAAGCACATCTCTGTATAC
GGTTTCGCAAACGGCAGAGGTAAAACTCTTTGCTTCCTCACCCCAATGATTGAAAAATTT
AAAAGCTAAGAACCAATGAGCAAGCCTTGGTGTCCTCAAGCAATTATAATGGCTCACACA
AAGGATCTTTGTTTGCAAATTGGTAAACAAATAGCTGCTATTATGCCTCCAAGCAAAAAG
TATGAGATATCTTATCTCTTTAGAGACACTGATACCAAAGATATTAAGGGTTCTATTTGC
ATTGGCACTCCTGGTTATATCTAGAAAATATTAAACAGCATTAAAACTAAAGACCTAAAG
TTCTTAATTATTGACGAAGCTGATGAAGTCTTGGATTCTAACAAGAATGAGCTTAGGGAT
ACTCTAAACAAAATTTACGATGACATTAGTGAAGGTTTCTAGCTTATTTTGTTCTCAGCA
ACTTTTGAAGAAAGCGACATCGCAAATCTTGAAGAAATTATTGATGATGACGATTTTAAT
AAGGATGACATTAACTTTGAAGCTTTCTTTTAGATTTGA