Identifiers and Description

Gene Model Identifier

TTHERM_00316680

Standard Name

DRH28 (DExD/H box RNA helicase 28)

Aliases

PreTt20979 | 31.m00281 | 3687.m00083

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01389 ) ATP-dependent DNA helicase RecQ
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00316680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08406.19.997093137033517e-262DEAD/DEAH box helicase (611 aa
)
OxytrichaContig240.1.g1372.9985100291019436e-113DEAD/DEAH box helicase
SGDYFL002C1.9994050701445255e-104SPB4 Putative ATP-dependent RN
A helicase, nucleolar protein
required for synthesis of 60S
ribosomal subunits at a late s
tep in the pathway; sediments
with 66S pre-ribosomes in sucr
ose gradients
DictyBaseDDB_G02915883.000712232670428e-104ddx55 on chromosome: 6 positio
n 577637 to 579628
WormBaseWBGene000139839.000840820639671e-86Probable ATP-dependent RNA hel
icase DDX55 homolog status:P
artially_confirmed UniProt:P
34640 protein_id:CAA80151.1
Stentor CoeruleusSteCoe_58497.175095973164411e-66

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00316680(coding)
ATGAATACATTAAAGTAGAAATGGGAGGATTTAGAGACAAGACTCTTCCCTTAGGTTGAA
AAATGTGTCAAAGACGCTTTAGGCTATGAAACTATGATGCCTGTTTAGAAAGCTACAATC
CCATTATTTATCAAAAACCATGATTTAGCAGTAGAAGCATAAACTGGAAGTGGCAAAACA
TTAGCATTTTTGCTTCCTATCTTTAATGTTTTGATAAAGCAAGTAAAAACAGCAAATAAA
AATTGTGTTTATGCATTAGTTATTGCTCCTACTAGAGAGTTAGCAAAATAAATTCATGAA
ATAGCTGTTTAGTTAGCGAGTCATTTAGAAAATAATTAATTCAGCATTCAACTTTGTATA
GGTGGTGTAAGCACTAAAATAGATGTATCTAATATTCAGTCATAAGGTGCTAACATTTTA
ATTGCCACTCCTGGTAAACTCAAAGAGCTGATGGATATGAAAGAGTTAGAAGATAGTTTA
ATTTTTAGGAATCTTGAAATATTGATTATGGATGAAGCAGATAGATTAATGGATACAGAG
TATTATGAAGATATGACCTATGCATTAGAAAAGCTTCCAAAATAAAGAAGAACAGGCTTG
TTTTCAGCAACTTTGAGCTCTGCAAAATTAAGTGAATTGATTAAATACGGTCTCCGTAAC
CCAGTTAAAGTTTCAGTCAAACCTGGTGGTGAAAAAGCTAATAACACTAATTATGTTGTT
CCTTCCACCCTAGAAAACTCTTACTTGATTCTTGACAATAGATTTTAAAAGATAGCATTT
ATGCTTAATTTCATTTTAAAGTATCCTGAAGAGAAAACTATCCTTTTCTTAAATACTTGT
GCAAGTGTTGACTTTTACTAAAAAATTTTCAAAATGTACAGCTTAATTAAAAAAATACAA
ATTACTTCTGTGCATGGATAAATGAAATAAGTTAAAAGAAATAAAATTATTGAAAACTTT
ACAAAGAGCTAAAAGGGAGTCTTAATTTGTACAGATGTTGTTGCAAGAGGTATAGATTTC
TAAGATGTCCACCATATTTTATAAATAGATCCTCCATAAGATCCAAGTTTTTACATTCAT
AGAATAGGTAGAACAGCTAGAAAGGGAAAATCAGGAAAGGCTATTATACTCATTGAAAAA
CATGAAGAGGCATTTGTAGAATTTCTAAGAATTAAAAATGTTGAGATTCAGGAATACAAT
AATTCTGAATAAATAGAATGTGATCCCCTAAAATTTGAAGAAGATATTAAAAAAATAATG
ATATAAGATAGAGATAATATAGAAAAATCTAAAAAAGCATTTATTTCTTATATTAGGTCT
TACATGGAACATGATCTTAAGTATATATTTGAATTCAAAGATTTAGACATAGGTTGGGTG
GCTCGCTCATTCTTTTTATTGAGACTGCCTCGTATTAAGGAAATTCTCAGCAAACATATA
AAGAATTTTCATTAAAGCGAAATTGATCCAGACACTATACCATTTTAAGATAAAAATTAA
GAACAATAGTTTTCTCTTAAATAAGAAGAAAGAACATAAAAAAGATAAGAAAGAGAAGAG
CATGCAGAAAAGCAATAAAAATAATTAGAGAAAAAGTAAAAAGAAAAGAATATGCGTTAG
GTGAGAAGAAAATAAAAAAGGGAAGTATTAGAAGAAGAATAAGATGAATTTTCCTTGGAA
TTAAACTTAGCAAAGAAGCTAAAATAGGGTAAAATTACTCTTTAGGAATATAAAAAACGT
ATGAAAGAAATAGATCCTGAAGATTTACATGATGTTGAATTTACTAAGAAATAAATAGTA
TCAATTTCAGGTCATAAGAAGAAGAAGAAATGA


>TTHERM_00316680(protein)
MNTLKQKWEDLETRLFPQVEKCVKDALGYETMMPVQKATIPLFIKNHDLAVEAQTGSGKT
LAFLLPIFNVLIKQVKTANKNCVYALVIAPTRELAKQIHEIAVQLASHLENNQFSIQLCI
GGVSTKIDVSNIQSQGANILIATPGKLKELMDMKELEDSLIFRNLEILIMDEADRLMDTE
YYEDMTYALEKLPKQRRTGLFSATLSSAKLSELIKYGLRNPVKVSVKPGGEKANNTNYVV
PSTLENSYLILDNRFQKIAFMLNFILKYPEEKTILFLNTCASVDFYQKIFKMYSLIKKIQ
ITSVHGQMKQVKRNKIIENFTKSQKGVLICTDVVARGIDFQDVHHILQIDPPQDPSFYIH
RIGRTARKGKSGKAIILIEKHEEAFVEFLRIKNVEIQEYNNSEQIECDPLKFEEDIKKIM
IQDRDNIEKSKKAFISYIRSYMEHDLKYIFEFKDLDIGWVARSFFLLRLPRIKEILSKHI
KNFHQSEIDPDTIPFQDKNQEQQFSLKQEERTQKRQEREEHAEKQQKQLEKKQKEKNMRQ
VRRKQKREVLEEEQDEFSLELNLAKKLKQGKITLQEYKKRMKEIDPEDLHDVEFTKKQIV
SISGHKKKKK


>TTHERM_00316680(gene)
ATGAATACATTAAAGTAGAAATGGGAGGATTTAGAGACAAGACTCTTCCCTTAGGTTGAA
AAATGTGTCAAAGACGCTTTAGGCTATGAAACTATGATGCCTGTTTAGAAAGCTACAATC
CCATTATTTATCAAAAACCATGATTTAGCAGTAGAAGCATAAACTGGAAGTGGCAAAACA
TTAGCATTTTTGCTTCCTATCTTTAATGTTTTGATAAAGCAAGTAAAAACAGCAAATAAA
AATTGTGTTTATGCATTAGTTATTGCTCCTACTAGAGAGTTAGCAAAATAAATTCATGAA
ATAGCTGTTTAGTTAGCGAGTCATTTAGAAAATAATTAATTCAGCATTCAACTTTGTATA
GGTGGTGTAAGCACTAAAATAGATGTATCTAATATTCAGTCATAAGGTGCTAACATTTTA
ATTGCCACTCCTGGTAAACTCAAAGAGCTGATGGATATGAAAGAGTTAGAAGATAGTTTA
ATTTTTAGGAATCTTGAAATATTGATTATGGGTAATTTATTGTAATTATAAGGTTTTGAT
TTCTAGTATTTAATAGCAAAGGTTTCCTTGAAGCTATTTCAATAATAAAGCTAAATTTTG
AAGGTTTTATGCAATTTAGCAAAATAAATGTTAATATTAATGGATAAAAATAAATTTTGA
TTATAAAAATACTGGTTTTCTTTAATGATATGACTTTAATTTAAATAAAATTAATATTTT
ATAATGTTAAATTTTTTTTATTCTATAAAGATGAAGCAGATAGATTAATGGATACAGAGT
ATTATGAAGATATGACCTATGCATTAGAAAAGCTTCCAAAATAAAGAAGAACAGGCTTGT
TTTCAGCAACTTTGAGCTCTGCAAAATTAAGTGAATTGATTAAATACGGTCTCCGTAACC
CAGTTAAAGTTTCAGTCAAAGTATTTAAAACATTTTATGAAATTCGAAATTTTTGATTAT
TAAAATTAAAATTTTATATAAAGCCTGGTGGTGAAAAAGCTAATAACACTAATTATGTTG
TTCCTTCCACCCTAGAAAACTCTTACTTGATTCTTGACAATAGATTTTAAAAGATAGCAT
TTATGCTTAATTTCATTTTAAAGTATCCTGAAGAGAAAACTATCCTTTTCTTAAATACTT
GTGCAAGTGTTGACTTTTACTAAAAAATTTTCAAAATGTACAGCTTAATTAAAAAAATAC
AAATTACTTCTGTGCATGGATAAATGAAATAAGTTAAAAGAAATAAAATTATTGAAAACT
TTACAAAGAGCTAAAAGGGAGTCTTAATTTGTACAGATGTTGTTGCAAGAGGTATAGATT
TCTAAGATGTCCACCATATTTTATAAATAGATCCTCCATAAGTAATTTTTTAGTATTTGT
TAGTATTTGGTATTAAAGAATGTAAATTTTTAATAGGATCCAAGTTTTTACATTCATAGA
ATAGGTAGAACAGCTAGAAAGGGAAAATCAGGAAAGGTAAATAAATATTTAAATTTTATT
TAGTCTAAAAATTGATTAAATAGGCTATTATACTCATTGAAAAACATGAAGAGGCATTTG
TAGAATTTCTAAGAATTAAAAATGTAAATTATTACTTATAATTTAATTGTTTAAAATTAA
TTATTTTTGGGATAACTTTTAGGTTGAGATTCAGGAATACAATAATTCTGAATAAATAGA
ATGTGATCCCCTAAAATTTGAAGAAGATATTAAAAAAATAATGATATAAGATAGAGATAA
TATAGAAAAATCTAAAAAAGCATTTATTTCTTATATTAGGTCTTACATGGAACATGATGT
ATGTTAAATTAAATTGAAAGCAGTAATTAATAAAATAATTTTTTTACACAATAGCTTAAG
TATATATTTGAATTCAAAGATTTAGACATAGGTTGGGTGGCTCGCTCATTCTTTTTATTG
AGACTGCCTCGTATTAAGGAAATTCTCAGCAAACATATAAAGAATTTTCATTAAAGCGAA
ATTGATCCAGACACTATACCATTTTAAGATAAAAATTAAGAACAATAGTTTTCTCTTAAA
TAAGAAGAAAGAACATAAAAAAGTAAATTAAAGTAATCTTAAGAAATAACCTCAATGTTT
TTTTTAATTTTATAGGATAAGAAAGAGAAGAGCATGCAGAAAAGCAATAAAAATAATTAG
AGAAAAAGTAAAAAGAAAAGAATATGCGTTAGGTGAGAAGAAAATAAAAAAGGGAAGTAT
TAGAAGAAGAATAAGATGAATTTTCCTTGGAATTAAACTTAGCAAAGAAGCTAAAATAGG
GTAAAATTACTCTTTAGGAATATAAAAAACGTATGAAAGAAATAGATCCTGAAGATTTAC
ATGATGTTGAATTTACTAAGAAATAAATAGTATCAATTTCAGGTCATAAGAAGAAGAAGA
AATGA