Identifiers and Description

Gene Model Identifier

TTHERM_00196320

Standard Name

DRH27 (DExD/H box RNA helicase 27 )

Aliases

PreTt06817 | 16.m00473

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( PF04665 ) Poxvirus A32 protein
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF08225 ) Pseudin antimicrobial peptide
  • ( TIGR01967 ) ATP-dependent helicase HrpA
  • ( TIGR01970 ) ATP-dependent helicase HrpB
  • ( PF04408 ) Helicase associated domain (HA2)
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF07717 ) Domain of unknown function (DUF1605)
  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF08011 ) Protein of unknown function (DUF1703)
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00196320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03805.19.997093137033517e-262helicase domain-containing pro
tein (2036 aa)
OxytrichaContig13549.0.g401.999129405549486e-73Oligonucleotide/oligosaccharid
e-binding (OB)-fold
DictyBaseDDB_G02911839.995417076252815e-72dhx8 on chromosome: 5 position
5107365 to 5110847
SGDYER013W6.001182358613152e-70PRP22 DEAH-box RNA-dependent A
TPase/ATP-dependent RNA helica
se, associates with lariat int
ermediates before the second c
atalytic step of splicing; med
iates ATP-dependent mRNA relea
se from the spliceosome and un
winds RNA duplexes
WormBaseWBGene000189677.003229617538552e-69locus:ddx-15 status:Confirme
d UniProt:G8JY03 protein_i
d:CCD63139.1
Stentor CoeruleusSteCoe_90951.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00196320(coding)
ATGGGTTAAGAGCATTCTAAAAATAACAATTAAGATAATAAGGAAGTCAATAAAGATAAT
AGAAAGGATGATTTTAAACATTCTTAAAGGGATAACAGGGGTGAATAAATTCAAGATTAA
AGCAATTAACCATTACAAAGCGAAAAGCTTTAAGAATAAAATTTTAGAAATAAAAGGTAG
GGTTATGGGTAATAGTTTTAAGGTAATTAAATTAAAGAAGAAGAGTAACTTTAAGATTAG
AGTGAATTTTAAAATGAATTTAAGAAAAAAAGAGAGTAAAAGAGTTATCATCATAAAGAA
TAATACAAAAACTATTAATAAAATGAAAAAACTCGAAATTACAGAATGTTTTAACATCCC
AAAAAAGGAGATAATAATTAAATAGAAGAAGAAGAAATTTAGATGTAGAAATAAGGATAA
ATAATAGATTATTAGTAGAATAATAAATTTAAGAATTAATAAAATGAATTCAAAGAAAGA
TATAAAAAATAAAAATACGATGACAGAAATGAAAAAATACATGATCGAATCAATTAAAGT
GAATAGTAGATGAATCAAAATTTTGAAGAAAATACACAAGAATAGTAATAAAATCATAAA
TATAGTAACTACCAAAAAGAATTCAAAGATAAATAGAGAAAGTAAAAATATAATGATAGG
AATGTAAATGTTTAATAACATAATTAATTCAAAAAATAAGATGAAGAATTTTCTGAAGAT
CAAAGGTATTTTAAAAAACCTTAAAACAGATAAAGCACTGAAGATGATTTACAAAGTTAA
TAACAAAAGTAGCAAAAAATTCAAGATTTAAAAATTATTAATCAATTTTGCAAGTAACAT
TTTAGCTTTAGCTTACTTAGAGAAGATGAAAACTCTTGGTTCAATGTTAATTATAGCAAT
TTATTGTCTAATATTTAACTTAAAGAAATACTTTATTAGATGAGAAGTGCTTTAAAGTAT
TTAGCTGAATACTTGAAATAACACATAGATATCAATTAACAAAATAAATAATTCAACAAT
TATGAGATAAATTATATGAATTTAATCAAATTGTATATAAATAATATAGCTGATCTCAAA
TAAAGAGTTGACTAAGGCATAAATAAAAAAATTTCTCAACTTATTAATCATGCTGCTTTA
ATTGAAACATAAACTAATTTAGATAATTCTGAAGTATAATTTGAAAATAAATTTTACTCT
CAAGATGAAATAGCAAATTAGCTTTAATCCTAATAAATAGTGAATCAATTAAAATTGAAG
AGTGAAAATTCTAATAGTAATTAATAGGATTAAGAAATTTAGATTGTCTAATAAAACCTC
TAAGATTTCAGTAACAGCAAAGATCGTGATGAAGATAACCAATATGACGAAGAGGTAGGA
TTTTCTGAAGAGCTAAGTGATTCTTAAAATTTAGATACCTAGTCAGATATAAAGAATTTA
AGTGCAGAGTAAATAAGTTACTTATCAAAATTTTATTACTCCATTTTAAATAAATTTACT
ATTGCTTTGAAAATGGAGAAAAGTATGTTGGCAAGAAACCTACCATCATACTAAATTAAG
AAGTAATTAATTCAGTAAGTTGAATAATCTAAGAACCCTTTTACACTACTAATTGGCACA
ACTGGATCTGGTAAAACTACTCAAATATGCTAATACATTTTACAAAAATAAATTTTGTCT
GATGATTTTACAAAGAAAATATATTGTGTTCAACCAAAAAGGCTGAATTGCTTAACTATT
TCAGATAGAGTAGCAAAAGAATTACACACTACTTTAGGATAAGAAGTGGGATATATTGTT
GGGTATTAGAAACACGAATAGCTTTATGATAAAAATAAGACTCGCATAATATTTATAACT
CAAGCAATGTTTTTAAGTTTTTTAGTCCAAAGAATCAAAAAACTGTCTGAAAAGTAATAA
CAGCTTAATTAGTGTCGAATTCTTAGCTAAATAAGTTACATTTTACTTGATGAAGTACAT
GAAAGAACTGTAGAAGCTGACATAATTATGGGAATTTTAAAATAGTGTATTGATAATACT
TCGAATATTAAAGTAATTCTATCATCTGCTACTGTTAATACTGAAAAATATTTGAAATTC
TTTTAGCAAGACGAAATTCCTATGGAACTTTGCTAAATACCAGGGAAGATATATGAAATT
GACGAAATCTTTTGCAATGATTTGTATGGTAGCAATGTCAAAAAAGTTGTTTAAACTTTA
AAACATGTTATTTCTATGATACAGTAAGGAGATAGTCTTCATCAAGGACACATTTTGATA
TTTTTAACAGATGCACAAGATATTGAGCAATGTATTTCTGAGTGCAGAAAATTAACTTGC
ATAGATTTTAGAAAATACATACTCTTGGCTCTTCATAATAAAACAGATATCAATGACTAA
AATAAAATTTTCTAAGATCTCGTGAATCCCTATACAAATCAAATGGTGACTAAGATCATA
TTTGCTACAAATATTGCTGAATCAGCAATTACAATTAATAATGTAACTGTTGTAATTGAT
TCTGGTAAAGAAAATTGCCTTGTCTATGATCCTTTAAAGTGTATCTCTTCAATGAAAGAG
TAAAATATTTCCAAATCTTCAGCTATTCAGAGGTAAGGCAGAGCCGGAAGAACTTGTCCA
GGTATTTGCTACAAATTGTATACAGAATCTGAGTATGAATCTTTCCTTTAAGACAGTATT
CCTGAAATTTAAAGAATAAATATCGATTTTTCTGTGCTAAAATTGCTAGAGTGTGGTATT
TATAATTTATTTGCTTTTCCTTTTTTTGAAAACCCAGGATAGCAAGTCTTGTAAAATTCA
ATAACCAACCTGTAAAGACTAGGAGCAATAAACTAAGATGTATAAGTAACATAACTAGGT
AAAGTAATACAGTTTACTGAGCTTGAGCCATATTAAGCTAAGTGCTTGATAGAAGCTTCT
AAGAGAGATGTTTTAGATTAGGTTTTAAATATTTTTGCTTTTATGGCTGAAAATTAATCG
CTTTTCAAAAAATATGAAAAAGATTAGAGTTTTGAAGATAATTCAAAGAAATCTTAAATA
GAAATAGATATAAGCAATTATAAGAACGAATATAAGAGTGATTTCTTATTCTATAACTTT
TTGTTTAATAGAATAACTCAAGAGCTGCAAAATGATAAAAATTTTATTTCTAAAAATAAG
AAAATCAAAGAATCTGTTTTTCTTAATATTTATTTGAGTAAAAGGCATTTAAATTAAGTT
ATAAACTAAGCAAAGAAAATATTTTAAAATGAATTCAAAGTAGAAAATTAACTTTTATAA
GACAGTGAAGAAGTTAGAATTTAAAAGTGTATGCTATGCTGCTATTTGAACTAAATTGGT
ACTTACACTGGATCTAGAATTTTAGGATTTACTAACATTTATAACGAGATTAACTTCTCG
ATTCATCGCTTCTCTAAATTTTGCAAATCTGAATTTAAAGAAGGAGATTGCTTATTCTAT
GCTTCTCTTGAAAATGTAGAGTCTGAAAATTATGCATAACATATTTCTATTTTCAAAAGA
GAATGGTTAGAAGATGAATCCATCATTCCTAGCAACATGATGACCAAAATTTAAGCAGAA
CTGGTTAAGAAAATTATCCCTAAATATATTTGTAATATTGATGTAAGCAGATATATTTTA
TTGGCATTTAAAAAGAAGTACTCTGAAAAGATAAATGAATATTTAAAATAATTAAGCTAA
AATAATCCTAAACTAAAAATATTTATGATCATTGATGAGAGTAGTTGCTCAATAAAATTC
TTAGGCAGTTAGGAAGGGGAAATCGCTTTTAAAGAATAATTAGTCTAAGAGAATATACTT
AGGATACTAAACGATGAAAGAACGAAGCAAAGAAAGAATATTGTGATACGAAAGTACAAA
GAATCTGAAAATTATGTAGTATTTGGTTAAGGATACTAGATATTAGACATATTACTACCT
CATGAATATGTTAAAGTGAGAGTTTATAATTTCCCCAGTAAAATTTAAGGATAATAAGTA
ACAGAGAAAACTGTTGAATAATTTTTTATGCTTGATTAAAATAAAGATTATTTCAATGTT
TTTTTTCAAAAAAATTCATTTGATAAGATGGCTATTTACATTGTTTTTAGAAATTATGAA
AGTGCTAAAAACTTTTTATATTAATTCAATTTAAATATGCCTTAATAATATAAGGATATT
TATATTTAAGGTGTACCAGAATCGAGAGCTTCTCAAAAATTAGAGATTGTTTCTGTTATA
GCTGAATGGCCAATAGCAAAATCTTTGGGAAAGGCATAAATTATTTTTAATAACTAAATT
GATAGAGATGCAACATATAATAGATTGCTTTACTAATATATTAATGGCATTAAAATAAAA
GTATTCCAGCATGATCCTGAGCCTAAATAGCATCAACAGCTAGTAAAAAATTATTGTATA
AATATAAACTCTTTGAGTCAGCAAACTACTGAATAAGACATAAAACATTTTATATCTAAT
CAGTATGGAGGATTTGAAAATATTTTGATAAGAAGAGAAGAAATTAAGGTAGATGAGACA
TAAAGGCTATAAAATATTGAAAGATACACAAATCAGCTAAAGACTTTAATGAGCAAAATT
GTTAATGAGGAAGAGCTTTAATAAATTTAAATCTAATATGATAACCCTAAAAAAGGATAA
ATGAAAGCAAGAATTTAGTTTCCAAAGGCAATCTAAGCTGAAAAATTTTAGTAGTTATAC
AATAAACAAGTGTTCGAGCAAGGAAGGTTGAATTTATACATTTAAAATCAACAAAGATTT
ACTTTGAAAATAAAAGCATATGAAATAATTAAAGATTAATTTGAAAAAATCATATTAAAA
TTTAAGGACTCAATCTTTATTGATGTAAAATATGCAGATTATGAAGTTTTAATAAATTTA
AAGTCTTAAATAGATTTTAAGTAAAATTTATTGTAAAACAATACTCAAGAAACTCAAAAT
CTCTTTAAGTTAATAACTCAGTAGATAAAGATACTTTTCAAACCCTTAATAATAAACTTT
GATATTCATCCAAGAGATTTCATTTAGTAGTATGAAAAGAATATTCAAATATTTGAGAAA
ATTTAAAATCAACTAAAGGTCTGCATCATACCAACACCTAAGAAAGCAGAAATATAAGTA
TGGTTCGAAGAATAAAATGAAAATGCTAAATAGAAAATTATTTAGAAAATATAGATAGCT
TTTTAATAAAATATTATTTCATAGAAACTACTGAAAAAAAAGTGGTACAATCAAAAGTAG
TTGCAAGATCAAATATAAAATTTAGTAAGATAAAATTTTATTTCAAATTATGATGAAAAA
TAAGACTCTATCATTATTAAAGGAGTTTAATCTTAGCTGTAAAAAGCTCTAAGAATAATT
AATTAAGAATGTAGATTAGTATAATCTACATAATCATGTAAAATTTGCTTCGAAGATAAG
CTGATAGAAAAAATAGATAACTGCGGATGCACTTACTGTTAGGATTGTTTGTTGCAGCAT
GTATTATCAAGTGCTATTAATAGCGAATGTGTATGCTGTCCTGACCACAAGGAATCTCTG
ATAAATATAGAAGATATCAAGGATTTTATTTCCTAGCTTGATGAAGAAAAACTAATTAAT
GATAAAATTAATTCCTAAATAGATACATGGAAAAATAAAAAAGTAAACTTATCTAAATTT
ATTAGATGCACATCTATAAACTGCGACTCTTTCTTCGGTAAAAAGTATTACGATAAAAAT
TAGTAAGAAGTTGATGTGGACATGCCAAGTGAGCTAAAATGTCCTGAATGCTTCTACAGT
TTCTGCTTAAAGCAAACAACATATGGAATTATGAAATTACATAATTATCATAGTACTGGA
TATTGTTTGGCTGAAAGTGATTAATAAGTTGTAGAGTAGTTAAAAAAATTAAACTATAAG
CAGTGCCCAGGTTGCAATGATATGATATAAAAAAGTATGGGTTGTAACCATATGACTTGT
AAATGTGGTGCTCATTTTTGCTTTTAATGCTTATATTATCCAACTCCATCAAATGCCCAG
GCTATTTATAGTCATATGGCAACTGAAAGACATTGA


>TTHERM_00196320(protein)
MGQEHSKNNNQDNKEVNKDNRKDDFKHSQRDNRGEQIQDQSNQPLQSEKLQEQNFRNKRQ
GYGQQFQGNQIKEEEQLQDQSEFQNEFKKKREQKSYHHKEQYKNYQQNEKTRNYRMFQHP
KKGDNNQIEEEEIQMQKQGQIIDYQQNNKFKNQQNEFKERYKKQKYDDRNEKIHDRINQS
EQQMNQNFEENTQEQQQNHKYSNYQKEFKDKQRKQKYNDRNVNVQQHNQFKKQDEEFSED
QRYFKKPQNRQSTEDDLQSQQQKQQKIQDLKIINQFCKQHFSFSLLREDENSWFNVNYSN
LLSNIQLKEILYQMRSALKYLAEYLKQHIDINQQNKQFNNYEINYMNLIKLYINNIADLK
QRVDQGINKKISQLINHAALIETQTNLDNSEVQFENKFYSQDEIANQLQSQQIVNQLKLK
SENSNSNQQDQEIQIVQQNLQDFSNSKDRDEDNQYDEEVGFSEELSDSQNLDTQSDIKNL
SAEQISYLSKFYYSILNKFTIALKMEKSMLARNLPSYQIKKQLIQQVEQSKNPFTLLIGT
TGSGKTTQICQYILQKQILSDDFTKKIYCVQPKRLNCLTISDRVAKELHTTLGQEVGYIV
GYQKHEQLYDKNKTRIIFITQAMFLSFLVQRIKKLSEKQQQLNQCRILSQISYILLDEVH
ERTVEADIIMGILKQCIDNTSNIKVILSSATVNTEKYLKFFQQDEIPMELCQIPGKIYEI
DEIFCNDLYGSNVKKVVQTLKHVISMIQQGDSLHQGHILIFLTDAQDIEQCISECRKLTC
IDFRKYILLALHNKTDINDQNKIFQDLVNPYTNQMVTKIIFATNIAESAITINNVTVVID
SGKENCLVYDPLKCISSMKEQNISKSSAIQRQGRAGRTCPGICYKLYTESEYESFLQDSI
PEIQRINIDFSVLKLLECGIYNLFAFPFFENPGQQVLQNSITNLQRLGAINQDVQVTQLG
KVIQFTELEPYQAKCLIEASKRDVLDQVLNIFAFMAENQSLFKKYEKDQSFEDNSKKSQI
EIDISNYKNEYKSDFLFYNFLFNRITQELQNDKNFISKNKKIKESVFLNIYLSKRHLNQV
INQAKKIFQNEFKVENQLLQDSEEVRIQKCMLCCYLNQIGTYTGSRILGFTNIYNEINFS
IHRFSKFCKSEFKEGDCLFYASLENVESENYAQHISIFKREWLEDESIIPSNMMTKIQAE
LVKKIIPKYICNIDVSRYILLAFKKKYSEKINEYLKQLSQNNPKLKIFMIIDESSCSIKF
LGSQEGEIAFKEQLVQENILRILNDERTKQRKNIVIRKYKESENYVVFGQGYQILDILLP
HEYVKVRVYNFPSKIQGQQVTEKTVEQFFMLDQNKDYFNVFFQKNSFDKMAIYIVFRNYE
SAKNFLYQFNLNMPQQYKDIYIQGVPESRASQKLEIVSVIAEWPIAKSLGKAQIIFNNQI
DRDATYNRLLYQYINGIKIKVFQHDPEPKQHQQLVKNYCININSLSQQTTEQDIKHFISN
QYGGFENILIRREEIKVDETQRLQNIERYTNQLKTLMSKIVNEEELQQIQIQYDNPKKGQ
MKARIQFPKAIQAEKFQQLYNKQVFEQGRLNLYIQNQQRFTLKIKAYEIIKDQFEKIILK
FKDSIFIDVKYADYEVLINLKSQIDFKQNLLQNNTQETQNLFKLITQQIKILFKPLIINF
DIHPRDFIQQYEKNIQIFEKIQNQLKVCIIPTPKKAEIQVWFEEQNENAKQKIIQKIQIA
FQQNIISQKLLKKKWYNQKQLQDQIQNLVRQNFISNYDEKQDSIIIKGVQSQLQKALRII
NQECRLVQSTQSCKICFEDKLIEKIDNCGCTYCQDCLLQHVLSSAINSECVCCPDHKESL
INIEDIKDFISQLDEEKLINDKINSQIDTWKNKKVNLSKFIRCTSINCDSFFGKKYYDKN
QQEVDVDMPSELKCPECFYSFCLKQTTYGIMKLHNYHSTGYCLAESDQQVVEQLKKLNYK
QCPGCNDMIQKSMGCNHMTCKCGAHFCFQCLYYPTPSNAQAIYSHMATERH


>TTHERM_00196320(gene)
ATGGGTTAAGAGCATTCTAAAAATAACAATTAAGATAATAAGGAAGTCAATAAAGATAAT
AGAAAGGATGATTTTAAACATTCTTAAAGGGATAACAGGGGTGAATAAATTCAAGATTAA
AGCAATTAACCATTACAAAGCGAAAAGCTTTAAGAATAAAATTTTAGAAATAAAAGGTAG
GGTTATGGGTAATAGTTTTAAGGTAATTAAATTAAAGAAGAAGAGTAACTTTAAGATTAG
AGTGAATTTTAAAATGAATTTAAGAAAAAAAGAGAGTAAAAGAGTTATCATCATAAAGAA
TAATACAAAAACTATTAATAAAATGAAAAAACTCGAAATTACAGAATGTTTTAACATCCC
AAAAAAGGAGATAATAATTAAATAGAAGAAGAAGAAATTTAGATGTAGAAATAAGGATAA
ATAATAGATTATTAGTAGAATAATAAATTTAAGAATTAATAAAATGAATTCAAAGAAAGA
TATAAAAAATAAAAATACGATGACAGAAATGAAAAAATACATGATCGAATCAATTAAAGT
GAATAGTAGATGAATCAAAATTTTGAAGAAAATACACAAGAATAGTAATAAAATCATAAA
TATAGTAACTACCAAAAAGAATTCAAAGATAAATAGAGAAAGTAAAAATATAATGATAGG
AATGTAAATGTTTAATAACATAATTAATTCAAAAAATAAGATGAAGAATTTTCTGAAGAT
CAAAGGTATTTTAAAAAACCTTAAAACAGATAAAGCACTGAAGATGATTTACAAAGTTAA
TAACAAAAGTAGCAAAAAATTCAAGATTTAAAAATTATTAATCAATTTTGCAAGTAACAT
TTTAGCTTTAGCTTACTTAGAGAAGATGAAAACTCTTGGTTCAATGTTAATTATAGCAAT
TTATTGTCTAATATTTAACTTAAAGAAATACTTTATTAGATGAGAAGTGCTTTAAAGTAT
TTAGCTGAATACTTGAAATAACACATAGATATCAATTAACAAAATAAATAATTCAACAAT
TATGAGATAAATTATATGAATTTAATCAAATTGTATATAAATAATATAGCTGATCTCAAA
TAAAGAGTTGACTAAGGCATAAATAAAAAAATTTCTCAACTTATTAATCATGCTGCTTTA
ATTGAAACATAAACTAATTTAGATAATTCTGAAGTATAATTTGAAAATAAATTTTACTCT
CAAGATGAAATAGCAAATTAGCTTTAATCCTAATAAATAGTGAATCAATTAAAATTGAAG
AGTGAAAATTCTAATAGTAATTAATAGGATTAAGAAATTTAGATTGTCTAATAAAACCTC
TAAGATTTCAGTAACAGCAAAGATCGTGATGAAGATAACCAATATGACGAAGAGGTAGGA
TTTTCTGAAGAGCTAAGTGATTCTTAAAATTTAGATACCTAGTCAGATATAAAGAATTTA
AGTGCAGAGTAAATAAGTTACTTATCAAAATTTTATTACTCCATTTTAAATAAATTTACT
ATTGCTTTGAAAATGGAGAAAAGTATGTTGGCAAGAAACCTACCATCATACTAAATTAAG
AAGTAATTAATTCAGTAAGTTGAATAATCTAAGAACCCTTTTACACTACTAATTGGCACA
ACTGGATCTGGTAAAACTACTCAAATATGCTAATACATTTTACAAAAATAAATTTTGTCT
GATGATTTTACAAAGAAAATATATTGTGTTCAACCAAAAAGGCTGAATTGCTTAACTATT
TCAGATAGAGTAGCAAAAGAATTACACACTACTTTAGGATAAGAAGTGGGATATATTGTT
GGGTATTAGAAACACGAATAGCTTTATGATAAAAATAAGACTCGCATAATATTTATAACT
CAAGCAATGTTTTTAAGTTTTTTAGTCCAAAGAATCAAAAAACTGTCTGAAAAGTAATAA
CAGCTTAATTAGTGTCGAATTCTTAGCTAAATAAGTTACATTTTACTTGATGAAGTACAT
GAAAGAACTGTAGAAGCTGACATAATTATGGGAATTTTAAAATAGTGTATTGATAATACT
TCGAATATTAAAGTAATTCTATCATCTGCTACTGTTAATACTGAAAAATATTTGAAATTC
TTTTAGCAAGACGAAATTCCTATGGAACTTTGCTAAATACCAGGGAAGATATATGAAATT
GACGAAATCTTTTGCAATGATTTGTATGGTAGCAATGTCAAAAAAGTTGTTTAAACTTTA
AAACATGTTATTTCTATGATACAGTAAGGAGATAGTCTTCATCAAGGACACATTTTGATA
TTTTTAACAGATGCACAAGATATTGAGCAATGTATTTCTGAGTGCAGAAAATTAACTTGC
ATAGATTTTAGAAAATACATACTCTTGGCTCTTCATAATAAAACAGATATCAATGACTAA
AATAAAATTTTCTAAGATCTCGTGAATCCCTATACAAATCAAATGGTGACTAAGATCATA
TTTGCTACAAATATTGCTGAATCAGCAATTACAATTAATAATGTAACTGTTGTAATTGAT
TCTGGTAAAGAAAATTGCCTTGTCTATGATCCTTTAAAGTGTATCTCTTCAATGAAAGAG
TAAAATATTTCCAAATCTTCAGCTATTCAGAGGTAAGGCAGAGCCGGAAGAACTTGTCCA
GGTATTTGCTACAAATTGTATACAGAATCTGAGTATGAATCTTTCCTTTAAGACAGTATT
CCTGAAATTTAAAGAATAAATATCGATTTTTCTGTGCTAAAATTGCTAGAGTGTGGTATT
TATAATTTATTTGCTTTTCCTTTTTTTGAAAACCCAGGATAGCAAGTCTTGTAAAATTCA
ATAACCAACCTGTAAAGACTAGGAGCAATAAACTAAGATGTATAAGTAACATAACTAGGT
AAAGTAATACAGTTTACTGAGCTTGAGCCATATTAAGCTAAGTGCTTGATAGAAGCTTCT
AAGAGAGATGTTTTAGATTAGGTTTTAAATATTTTTGCTTTTATGGCTGAAAATTAATCG
CTTTTCAAAAAATATGAAAAAGATTAGAGTTTTGAAGATAATTCAAAGAAATCTTAAATA
GAAATAGATATAAGCAATTATAAGAACGAATATAAGAGTGATTTCTTATTCTATAACTTT
TTGTTTAATAGAATAACTCAAGAGCTGCAAAATGATAAAAATTTTATTTCTAAAAATAAG
AAAATCAAAGAATCTGTTTTTCTTAATATTTATTTGAGTAAAAGGCATTTAAATTAAGTT
ATAAACTAAGCAAAGAAAATATTTTAAAATGAATTCAAAGTAGAAAATTAACTTTTATAA
GACAGTGAAGAAGTTAGAATTTAAAAGTGTATGCTATGCTGCTATTTGAACTAAATTGGT
ACTTACACTGGATCTAGAATTTTAGGATTTACTAACATTTATAACGAGATTAACTTCTCG
ATTCATCGCTTCTCTAAATTTTGCAAATCTGAATTTAAAGAAGGAGATTGCTTATTCTAT
GCTTCTCTTGAAAATGTAGAGTCTGAAAATTATGCATAACATATTTCTATTTTCAAAAGA
GAATGGTTAGAAGATGAATCCATCATTCCTAGCAACATGATGACCAAAATTTAAGCAGAA
CTGGTTAAGAAAATTATCCCTAAATATATTTGTAATATTGATGTAAGCAGATATATTTTA
TTGGCATTTAAAAAGAAGTACTCTGAAAAGATAAATGAATATTTAAAATAATTAAGCTAA
AATAATCCTAAACTAAAAATATTTATGATCATTGATGAGAGTAGTTGCTCAATAAAATTC
TTAGGCAGTTAGGAAGGGGAAATCGCTTTTAAAGAATAATTAGTCTAAGAGAATATACTT
AGGATACTAAACGATGAAAGAACGAAGCAAAGAAAGAATATTGTGATACGAAAGTACAAA
GAATCTGAAAATTATGTAGTATTTGGTTAAGGATACTAGATATTAGACATATTACTACCT
CATGAATATGTTAAAGTGAGAGTTTATAATTTCCCCAGTAAAATTTAAGGATAATAAGTA
ACAGAGAAAACTGTTGAATAATTTTTTATGCTTGATTAAAATAAAGATTATTTCAATGTT
TTTTTTCAAAAAAATTCATTTGATAAGATGGCTATTTACATTGTTTTTAGAAATTATGAA
AGTGCTAAAAACTTTTTATATTAATTCAATTTAAATATGCCTTAATAATATAAGGATATT
TATATTTAAGGTGTACCAGAATCGAGAGCTTCTCAAAAATTAGAGATTGTTTCTGTTATA
GCTGAATGGCCAATAGCAAAATCTTTGGGAAAGGCATAAATTATTTTTAATAACTAAATT
GATAGAGATGCAACATATAATAGATTGCTTTACTAATATATTAATGGCATTAAAATAAAA
GTATTCCAGCATGATCCTGAGCCTAAATAGCATCAACAGCTAGTAAAAAATTATTGTATA
AATATAAACTCTTTGAGTCAGCAAACTACTGAATAAGACATAAAACATTTTATATCTAAT
CAGTATGGAGGATTTGAAAATATTTTGATAAGAAGAGAAGAAATTAAGGTAGATGAGACA
TAAAGGCTATAAAATATTGAAAGATACACAAATCAGCTAAAGACTTTAATGAGCAAAATT
GTTAATGAGGAAGAGCTTTAATAAATTTAAATCTAATATGATAACCCTAAAAAAGGATAA
ATGAAAGCAAGAATTTAGTTTCCAAAGGCAATCTAAGCTGAAAAATTTTAGTAGTTATAC
AATAAACAAGTGTTCGAGCAAGGAAGGTTGAATTTATACATTTAAAATCAACAAAGATTT
ACTTTGAAAATAAAAGCATATGAAATAATTAAAGATTAATTTGAAAAAATCATATTAAAA
TTTAAGGACTCAATCTTTATTGATGTAAAATATGCAGATTATGAAGTTTTAATAAATTTA
AAGTCTTAAATAGATTTTAAGTAAAATTTATTGTAAAACAATACTCAAGAAACTCAAAAT
CTCTTTAAGTTAATAACTCAGTAGATAAAGATACTTTTCAAACCCTTAATAATAAACTTT
GATATTCATCCAAGAGATTTCATTTAGTAGTATGAAAAGAATATTCAAATATTTGAGAAA
ATTTAAAATCAACTAAAGGTCTGCATCATACCAACACCTAAGAAAGCAGAAATATAAGTA
TGGTTCGAAGAATAAAATGAAAATGCTAAATAGAAAATTATTTAGAAAATATAGATAGCT
TTTTAATAAAATATTATTTCATAGAAACTACTGAAAAAAAAGTGGTACAATCAAAAGTAG
TTGCAAGATCAAATATAAAATTTAGTAAGATAAAATTTTATTTCAAATTATGATGAAAAA
TAAGACTCTATCATTATTAAAGGAGTTTAATCTTAGCTGTAAAAAGCTCTAAGAATAATT
AATTAAGAATGTAGATTAGTATAATCTACATAATCATGTAAAATTTGCTTCGAAGATAAG
CTGATAGAAAAAATAGATAACTGCGGATGCACTTACTGTTAGGATTGTTTGTTGCAGCAT
GTATTATCAAGTGCTATTAATAGCGAATGTGTATGCTGTCCTGACCACAAGGAATCTCTG
ATAAATATAGAAGATATCAAGGATTTTATTTCCTAGCTTGATGAAGAAAAACTAATTAAT
GATAAAATTAATTCCTAAATAGATACATGGAAAAATAAAAAAGTAAACTTATCTAAATTT
ATTAGATGCACATCTATAAACTGCGACTCTTTCTTCGGTAAAAAGTATTACGATAAAAAT
TAGTAAGAAGTTGATGTGGACATGCCAAGTGAGCTAAAATGTCCTGAATGCTTCTACAGT
TTCTGCTTAAAGCAAACAACATATGGAATTATGAAATTACATAATTATCATAGTACTGGA
TATTGTTTGGCTGAAAGTGATTAATAAGTTGTAGAGTAGTTAAAAAAATTAAACTATAAG
CAGTGCCCAGGTTGCAATGATATGATATAAAAAAGTATGGGTTGTAACCATATGACTTGT
AAATGTGGTGCTCATTTTTGCTTTTAATGCTTATATTATCCAACTCCATCAAATGCCCAG
GCTATTTATAGTCATATGGCAACTGAAAGACATTGA