Identifiers and Description

Gene Model Identifier

TTHERM_00411600

Standard Name

DRH25 (DExD/H box RNA helicase 25)

Aliases

PreTt21578 | 44.m00245 | 3714.m00091

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF06994 ) Involucrin
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01967 ) ATP-dependent helicase HrpA
  • ( TIGR01970 ) ATP-dependent helicase HrpB
  • ( PF04408 ) Helicase associated domain (HA2)
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF07717 ) Domain of unknown function (DUF1605)
  • ( PF08432 ) Fungal protein of unknown function

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00411600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10352.19.997093137033517e-262hypothetical protein (1639 aa)
WormBaseWBGene000155252.0002546692351096e-156locus:rha-2 Putative ATP-dep
endent RNA helicase rha-2 st
atus:Partially_confirmed Uni
Prot:P34305 protein_id:CCD62
570.1
SGDYMR128W1.0001788721085356e-149ECM16 Essential DEAH-box ATP-d
ependent RNA helicase specific
to the U3 snoRNP, predominant
ly nucleolar in distribution,
required for 18S rRNA synthesi
s
OxytrichaContig20930.0.g431.99970314379378e-94Helicase associated domain (HA
2)
DictyBaseDDB_G02873512.9986068920536807e-84dhx37 on chromosome: 5 positio
n 165026 to 169507
Stentor CoeruleusSteCoe_168333.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00411600(coding)
ATGGGAAAGAAGTTAACAGCATAGTAAAAGCTTTAAAAGCTTTAAGAAAAGAAAAAAAAG
GATGCTGAAAGAAAAGAAATTTTGCTTGGCTTACAAAAAGGAGTCCAAGATTAAAAATAG
ATCATTGAAAAAATGACTTCTATAAAAGACATGGGCCTCTAAAATAAGATAGAAAAAAAA
CTTGAAAAAGAAAGAAAGCATAAAAAATCATTAGAGATGAAAAAGGAAACTGATGATTCT
AAATTAAGTGAAGAAGAAGAAGTAGAAGATTTTGAACCTGATGTTGAGAAAAAGTAGAAA
GTAGAAGAGGATGATGCTTAAAATAAGTAAAAGTAAGCATAGTAGCCCTCAGTAAATATA
TTTGCTTAAGCAGAATATATAAATCCAAACAAAGATGAAGAAGAAGAAGAAAGATTATAA
AAAGAATATGAATAAAAATTATAAAAGTAAAGGGAAATAGCTAATTCATAGATTTAGTTG
GAAAACCAAGTTAAAAAACTTATTCCTGATCTCAATTTTGATACTTTTGATGGAGCAAAA
ACCTCAAAGAGAGTTTTAGAAGATCTTAGCACTACTGATGAAATGCGTAAAGAAAAGCAA
AGGTTAGAAGAAGAATATTACAAAGAACCTGAATATGATGATTTTATTGAAGACGAATTA
TTAAAGCCTATATTGTAAGGTCAAAAAAAAGTATTTAATACAATAAACAGAAGCGATGAA
TAAGACAAAGCAAGAAAAAAATTACCTATTTTCATGAGAGAAGCAGATATTTTAGATGCA
GTAGAAAATAATTTAATTACTATCTTATGTGGTGAAACTGGAAGTGGTAAGAGTACATAA
ACTGTTTAGTTCCTTTATGAAGCAGGATATACTAATAAAGCAGGACCTAATCCTGGTATG
ATTGGTATTACTTAACCAAGAAGAATTGCAGCCATAGCTTTAGCTAAAAGAGTTTCAGAT
GAAATGAATATGACATTAGGTAAAGAGATCGTCTATCAAGTAAGACACGAACACTCTACT
TTTAATGAGGATTCTGCAATCAAATTTATGACAGATGGTATATTAATGAATGAAATGTGT
AGTGACTTTTTATTATCTAAGTACTCTGTAATTATGATTGATGAAGCTCACGAACGTAAA
ATTAATACTGATTTATTATTGGGATTACTATCTCGTCTTGTCAATATCAGAGCTAGACTT
GCTCTAGAAGAAAGAAAGAATGCTCCTTAAGATTAAACTAAATTTAAATATTATCCTTTA
AGAGTGATTATTATGTCAGCTACTTTACGTGTTGAAGATTTCACTTAAAATAAATACTTG
TTGCCAAAGAAAATTAATGTAATAAACGTAGAAGCAAGATAATTCCCTGTAAATACTTAT
TTTTCTAAAAGAACCCCTAATGATTATCTATAAGCTGCGGTAAAAAAGTGTTGTTAAATT
CATTCCGAATTACCTCCTGGTGATGTTTTAGTTTTCTTGACTGGTGAAAGAGAAATTAAA
GAATTTTGTATTACTCTAGAACAACAATTGAACAAGAAAAAGAGGGAAATAGATCTGGGT
AAACACGAATAAAAGGAATACACTGAAAAAGATTTCTTGCTTGATGATTCAGATGATGAA
GATGGAAAAGAAAAAATGGATGAAGAACAAGATGAATAAGATGAAGTTTAAAAGAAGTTA
GATGAGTTAGAAAATTAAGAATCTAAAAATTAAAATTCTATTTTTAGTTAAAAAAAGAAG
TTACGTTTTGAAGAGGATTAGGATCATGAAAATTAAGAATTTTTAAAAGCAGCAGATGAA
GAAGAAGAAAAAAACAGAGGAATTATTTAACACAATCCCATGGAATCTGAAAATTTAAAA
GCTTAAAAGAAAACTTTTCTTCATTTTAAAATCCTTCCTTTGTTCTCAAAATTACCACTT
TAAGAACAAGAAAAGATTTTTAAAAATAAGAGTCCTAATACTCGTCTTATTATAGCATCA
ACAAATGTTGCTGAAACATCTCTTACTATTCCAAATATTAAGTACGTAGTTGACTGTGGT
AGAGAAAAGAAAAAAATTTACTCAACAAAAGCATCCATTTCAAAGCATGTAATTAAGTGG
ATTTCTCAAGCATCTTGTGATTAAAGATAAGGTAGAGCTGGTAGAACTGGTCCTGGTTAT
TGTTATAGACTATTTGCACCATCTGTTTATGCAAATATTTTTGAAAAGTTTTCTGATCCT
GAAATACTTAGTATGCCATTAGAAAGTGTTATTTTACATCTCAAAGCCATTGGCATTTAA
GATGTTATTAAATTCCCTTATCCTACTCCTCCAAGCCTCTTGAATATGAAGAGAGCTTTA
TAAAATCTTGTAAAAATAAAAGCTCTCAGAGATAAAAATATGGACGTCGACCAAGAAATC
GAAGAAACTAACATAAATGAAGATGACAGAATTGATAAAAGTGAAATCACTGAGTTAGGA
AAAATTTTAGCATTCTTACCTATAAATCCAAGGTTTTCAAAAATGCTTCTTTAAGGCAGA
GCAGGAGGTGTAACTACATATGCACTCATTTTAGTAACTGCTTTGACCATTGAAGAACTG
TTTTGCAGAGGAGATTTCAGAATTGAAGAGAATCCTGCTGACAAATTAAAAGATGATTAT
TTAAAAGAAAATGATGAGTTGTATGCAAGTGATGAAGATTCAAAAATGAATGCTAAAGAT
ATTTTAAAATAGAAGCTGAACATGATTTAAGAGCAAAAAGAGTTAAAGAAAAAGTTGGTT
GAAAAACGTAGAGAAGAAATTGCCAGATTCAAAGAGTACTTCGAAAAGTTTATGATAGGA
AAAAGTGACCTTTTCATTCACATGAACATAATTGGTGAATTTATTGAAAAAATATACAAG
GATAACCCTTCAACTAGCAAGATTGAAGATTACATATATGAATATGCTAAAGAACGTCAT
TTACATCCTAAAGGAATGAAAGAAGTTTATTATAATCTCAATCAAATATCAGATATTTTA
GAGAGCATTATTGATGACCCTGAAGAAAAAAAATAAATTTCTTAGGGTTTCTAACCTTAT
GTTAAGCCTAATGCCACTCAACAAAAACTATTATAAGAGATAGTCATAAGTTGCTTTATT
GATTAATGTGCAAGAAAAGTCTTTTATTTGGATGAAGAAAATCGTAAAAAAGTAGCATAT
GAATGTTTGGAGACAACAGAAAGAGTGTTTATAAATTCTACATCATTTTTGATAAAAAAT
TAGCCAGATTTTATCGTATATACTGACATCATGGAAACCAAAAAGAAATATATGAACAAT
ATTACAATAGTTGAAGATGTATCTTTGCTTTATAAATACGATTATAGAACTACAAATAGA
AAATTGTAATATGTATATGAGCCTAAGCCATTTTATTCTAAGAAAAAAAATCAATTGGTT
ATTTTAGGTAAATCAACTTTTGGCAAAAGAAAATGGGATCTTCCTACATTTGAGACAACA
TTTTAAGAAGAAAGTATTGAAAAATACTGTTGGTTTGCTAGATGTTTGCTTGAAGGTTAG
GTCTTAGATTTCTTCAAAGCATGCAAGAGCCTCTATTAATTTGATCCTCAGATAATAAAA
TCATCTAATTTATAACCTAAAGTTTAAGCAATCGTTAATAAGCTTAAAAACAATCAAATT
GATAATTCTCAAAAGCTAGTTAAAAAGTGGGAGTCAGATAAATCTTTCTTACTTCCTGAA
GTTGCTTTGTGGATAAAAGATTAATATAAAGCTAATATATAGAAGAAATGGCCTCCTACT
TCTTGA


>TTHERM_00411600(protein)
MGKKLTAQQKLQKLQEKKKKDAERKEILLGLQKGVQDQKQIIEKMTSIKDMGLQNKIEKK
LEKERKHKKSLEMKKETDDSKLSEEEEVEDFEPDVEKKQKVEEDDAQNKQKQAQQPSVNI
FAQAEYINPNKDEEEEERLQKEYEQKLQKQREIANSQIQLENQVKKLIPDLNFDTFDGAK
TSKRVLEDLSTTDEMRKEKQRLEEEYYKEPEYDDFIEDELLKPILQGQKKVFNTINRSDE
QDKARKKLPIFMREADILDAVENNLITILCGETGSGKSTQTVQFLYEAGYTNKAGPNPGM
IGITQPRRIAAIALAKRVSDEMNMTLGKEIVYQVRHEHSTFNEDSAIKFMTDGILMNEMC
SDFLLSKYSVIMIDEAHERKINTDLLLGLLSRLVNIRARLALEERKNAPQDQTKFKYYPL
RVIIMSATLRVEDFTQNKYLLPKKINVINVEARQFPVNTYFSKRTPNDYLQAAVKKCCQI
HSELPPGDVLVFLTGEREIKEFCITLEQQLNKKKREIDLGKHEQKEYTEKDFLLDDSDDE
DGKEKMDEEQDEQDEVQKKLDELENQESKNQNSIFSQKKKLRFEEDQDHENQEFLKAADE
EEEKNRGIIQHNPMESENLKAQKKTFLHFKILPLFSKLPLQEQEKIFKNKSPNTRLIIAS
TNVAETSLTIPNIKYVVDCGREKKKIYSTKASISKHVIKWISQASCDQRQGRAGRTGPGY
CYRLFAPSVYANIFEKFSDPEILSMPLESVILHLKAIGIQDVIKFPYPTPPSLLNMKRAL
QNLVKIKALRDKNMDVDQEIEETNINEDDRIDKSEITELGKILAFLPINPRFSKMLLQGR
AGGVTTYALILVTALTIEELFCRGDFRIEENPADKLKDDYLKENDELYASDEDSKMNAKD
ILKQKLNMIQEQKELKKKLVEKRREEIARFKEYFEKFMIGKSDLFIHMNIIGEFIEKIYK
DNPSTSKIEDYIYEYAKERHLHPKGMKEVYYNLNQISDILESIIDDPEEKKQISQGFQPY
VKPNATQQKLLQEIVISCFIDQCARKVFYLDEENRKKVAYECLETTERVFINSTSFLIKN
QPDFIVYTDIMETKKKYMNNITIVEDVSLLYKYDYRTTNRKLQYVYEPKPFYSKKKNQLV
ILGKSTFGKRKWDLPTFETTFQEESIEKYCWFARCLLEGQVLDFFKACKSLYQFDPQIIK
SSNLQPKVQAIVNKLKNNQIDNSQKLVKKWESDKSFLLPEVALWIKDQYKANIQKKWPPT
S


>TTHERM_00411600(gene)
ATGGGAAAGAAGTTAACAGCATAGTAAAAGCTTTAAAAGCTTTAAGTAAGCTTAATATTA
TTTTGCTTAATATTTCAAGCATGCCTAAATAAATCAGAAATTTCATTTTTATCTTATAAA
ATATTTGATTAGGAAAAGAAAAAAAAGGATGCTGAAAGAAAAGAAATTTTGCTTGGCTTA
CAAAAAGGAGTCCAAGATTAAAAATAGATCATTGAAAAAATGACTTCTATAAAAGACATG
GGCCTCTAAAATAAGATAGAAAAAAAACTTGAAAAAGAAAGAAAGCATAAAAAATCATTA
GAGATGAAAAAGGAAACTGATGATTCTAAATTAAGTGAAGAAGAAGAAGTAGAAGGTAGT
TATGCATTTTCAAATATAAAATTCATCATTAAAACTATGATTATTATAATGCTATTATTT
TATTAAGCATTGTCTACTCACTTTTTAACTGATCATTATAAAATTGATTAGATTTTGAAC
CTGATGTTGAGAAAAAGTAGAAAGTAGAAGAGGATGATGCTTAAAATAAGTAAAAGTAAG
CATAGTAGCCCTCAGTAAATATATTTGCTTAAGCAGAATATATAAATCCAAACAAAGATG
AAGAAGAAGAAGAAAGATTATAAAAAGAATATGAATAAAAATTATAAAAGTAAAGGGAAA
TAGCTAATTCATAGATTTAGTTGGAAAACCAAGTTAAAAAACTTATTCCTGATCTCAATT
TTGATACTTTTGATGGAGCAAAAACCTCAAAGAGAGTTTTAGAAGATCTTAGCACTACTG
ATGAAATGCGTAAAGAAAAGCAAAGGTTAGAAGAAGAATATTACAAAGTAAATAGCATTT
TTACTTATTTTAGTAAATTTCATTTTAAAATCTACTTTTTATTCAAAAGTAGAATAAACT
TTCCATTAAACTACCACAAAGTATTTTATGATTATTTAAGAAATGCCTTTGAATAAAGCA
AAACAAAATAATCCAACTAATTTTATCATTTAAAAGAAGAAATTTTAAACTTAAATTGAT
TTTATAATTTAAATAATATTGAATGTAAATACATTTTTAGCATAATTTAACTTCATAAAA
ATTTGCAAATTCAATAAAAAGGATTAAAAAATTCTGTTTTTGGAATTGCATTTGCATTTA
AAGAAAATCAAATTTAGTTAGATAATTTTAGCATTTAAAAATAATAACTTAAATGATCTT
TGATATTTACAATAAAATTTGTCAAGATAATTTTTGATATTTATTATGAATTGACATATT
TTTTCTTTTGAAAATCTTTTTATATGATTTTTATTATTAAATTAGGAACCTGAATATGAT
GATTTTATTGAAGACGAATTATTAAAGCCTATATTGTAAGGTCAAAAAAAAGTATTTAAT
ACAATAAACAGAAGCGATGAATAAGACAAAGCAAGAAAAAAATTACCTATTTTCATGAGA
GAAGCAGATATTTTAGATGCAGTAGAAAATAATTTAATTACTATCTTATGTGGTGAAACT
GGAAGTGGTAAGAGTACATAAACTGTTTAGTTCCTTTATGAAGCAGGATATACTAATAAA
GCAGGACCTAATCCTGGTATGATTGGTATTACTTAACCAAGAAGAATTGCAGCCATAGCT
TTAGCTAAAAGAGTTTCAGATGAAATGAATATGACATTAGGTAAAGAGATCGTCTATCAA
GTAAGACACGAACACTCTACTTTTAATGAGGATTCTGCAATCAAAGTAATGCATTTTTTT
ATCTTTTTAGAATATTTAAAATTTTTACTATAAAATTAGTTTATGACAGATGGTATATTA
ATGAATGAAATGTGTAGTGACTTTTTATTATCTAAGTACTCTGTAATTATGATTGATGAA
GCTCACGAACGTAAAATTAATACTGATTTATTATTGGGATTACTATCTCGTCTTGTCAAT
ATCAGAGCTAGACTTGCTCTAGAAGAAAGAAAGAATGCTCCTTAAGATTAAACTAAATTT
AAATATTATCCTTTAAGAGTGATTATTATGTCAGCTACTTTACGTGTTGAAGATTTCACT
TAAAATAAATACTTGTTGCCAAAGAAAATTAATGTAATAAACGTAGAAGCAAGATAATTC
CCTGTAAATACTTATTTTTCTAAAAGAACCCCTAATGATTATCTATAAGCTGCGGTAAAA
AAGTGTTGTTAAATTCATTCCGAATTACCTCCTGGTGATGTTTTAGTTTTCTTGACTGGT
GAAAGAGAAATTAAAGAATTTTGTATTACTCTAGAACAACAATTGAACAAGAAAAAGAGG
GAAATAGATCTGGGTAAACACGAATAAAAGGAATACACTGAAAAAGATTTCTTGCTTGAT
GATTCAGATGATGAAGATGGAAAAGAAAAAATGGATGAAGAACAAGATGAATAAGATGAA
GTTTAAAAGAAGTTAGATGAGTTAGAAAATTAAGAATCTAAAAATTAAAATTCTATTTTT
AGTTAAAAAAAGAAGTTACGTTTTGAAGAGGATTAGGATCATGAAAATTAAGAATTTTTA
AAAGCAGCAGATGAAGAAGAAGAAAAAAACAGAGGAATTATTTAACACAATCCCATGGAA
TCTGAAAATTTAAAAGCTTAAAAGAAAACTTTTCTTCATTTTAAAATCCTTCCTTTGTTC
TCAAAATTACCACTTTAAGAACAAGAAAAGATTTTTAAAAATAAGAGTCCTAATACTCGT
CTTATTATAGCATCAACAAATGTTGCTGAAACATCTCTTACTATTCCAAATATTAAGTAC
GTAGTTGACTGTGGTAGAGAAAAGAAAAAAATTTACTCAACAAAAGCATCCATTTCAAAG
CATGTAATTAAGTGGATTTCTCAAGCATCTTGTGATTAAAGATAAGGTAGAGCTGGTAGA
ACTGGTCCTGGTTATTGTTATAGACTATTTGCACCATCTGTTTATGCAAATATTTTTGAA
AAGTTTTCTGATCCTGAAATACTTAGTATGCCATTAGAAAGTGTTATTTTACATCTCAAA
GCCATTGGCATTTAAGATGTTATTAAATTCCCTTATCCTACTCCTCCAAGCCTCTTGAAT
ATGAAGAGAGCTTTATAAAATCTTGTAAAAATAAAAGCTCTCAGAGATAAAAATATGGAC
GTCGACCAAGAAATCGAAGAAACTAACATAAATGTAAAGCTTGCTTTCTAACAAAAAACA
ATTTATTTATTTTTTTTAAAATTATTGATTTTTTAAAAAATTTTTATCCATTGAAATTTT
AGGAAGATGACAGAATTGATAAAAGTGAAATCACTGAGTTAGGAAAAATTTTAGCATTCT
TACCTATAAATCCAAGGTTTTCAAAAATGCTTCTTTAAGGCAGAGCAGGAGGTGTAACTA
CATATGCACTCATTTTAGTAACTGCTTTGACCATTGAAGAACTGTTTTGCAGAGGAGATT
TCAGAATTGAAGAGAATCCTGCTGACAAATTAAAAGATGATTATTTAAAAGAAAATGATG
AGTTGTATGCAAGTGATGAAGATTCAAAAATGAATGCTAAAGATATTTTAAAATAGAAGC
TGAACATGATTTAAGAGCAAAAAGAGTTAAAGAAAAAGTTGGTTGAAAAACGTAGAGAAG
AAATTGCCAGATTCAAAGAGTACTTCGAAAAGTTTATGATAGGAAAAAGTGACCTTTTCA
TTCACATGAACATAATTGGTGAATTTATTGAAAAAATATACAAGGATAACCCTTCAACTA
GCAAGATTGAAGATTACATATATGAATATGCTAAAGAACGTCATTTACATCCTAAAGGAA
TGAAAGAAGTTTATTATAATCTCAATCAAATATCAGATATTTTAGAGAGCATTATTGATG
ACCCTGAAGAAAAAAAATAAATTTCTTAGGGTTTCTAACCTTATGTTAAGCCTAATGCCA
CTCAACAAAAACTATTATAAGAGATAGTCATAAGTTGCTTTATTGATTAATGTGCAAGAA
AAGTCTTTTATTTGGATGAAGAAAATCGTAAAAAAGTAGCATATGAATGTTTGGAGACAA
CAGAAAGAGTGTTTATAAATTCTACATCATTTTTGATAAAAAATTAGCCAGATTTTATCG
TATATACTGACATCATGGAAACCAAAAAGTATATAAATGTTTAATATTATTTAGAAACTC
CGTATTATTACTATTCAATTCAAAAAGATTATGTACAACTAAGCTAAATATAAAAGAAAA
ATTCTTTTTAAAAAATCGGATATTTCTATTCAATAAATTAAATGCTTTTAAACATTAATT
TTTGCTATTAAAATATTACAATGATATAATTTTAAATAATTTTTAAAAAGCAGTTTATTT
AGTTTATATAAAATATTTTTTTACTTTTAAGAAATATTTTTAAGAGCTTGTTTTAAATTA
AATAAAAAATCATCTATTAAATCATAAATTATATCTATTAAATATTTTAAAATGTAGGAA
ATATATGAACAATATTACAATAGTTGAAGATGTATCTTTGCTTTATAAATACGATTATAG
AACTACAAATAGAAAATTGTAATATGTATATGAGCCTAAGCCATTTTATTCTAAGAAAAA
AAATCAATTGGTTATTTTAGGTAAATCAACTTTTGGCAAAAGAAAATGGGATCTTCCTAC
ATTTGAGGTAAATAGCAAATAAATTTGTATTTTTGATAATATATTATGAATGAATGCGTG
AAAGAAAAAAAAATTTTTTTTGGAAGACTTTATTTATTAAAAATGATGTTAATGAAACAT
GAAAATAGATTATGTTATTTTCAAATTAAGATAACTATTATTGAATCTCTTAAAATGGTA
TTAGCCAACAAAAAAGTTTTTTTCAGAAATTTTAATAAAAATAATGAGTGGTTTTAATAA
TTTAATTTCCTTTTCTTATGGTTGCATCAAAATTAATTATTATTATATTTTACATTTATT
TTTTACTTTCATCATTATTTAATAGAATTCGTTGATTTATTACGACACCAGTTTAAAAAA
AAAGTAAACTGAACGAATTTCTTCGGAAAGATTTTTTATAAATACAATAAAATAAATCTG
CATACATTTATATATTGATAAATGCTACTCATATCAACAACACTTCTCCTTTTATATTTT
CCAATAAATTATAAAACTTGCTAATGCACAATAAAATTACAATAAATCTATCTATTTTTT
TGTAGAAAAAGTCTTTTTACATTAAAGCTTTCTTTAGGAAAAATTACGTTTTTTTTTTAT
TTTTTGACCATTATCGCACATAATCTTTGAAAAAACAGATCAAAAAGTGAATAAAAAAAA
ACAAATATTAAACAATGTATTTAGTATTTAATTCATTTTAAATCTAGTTTACTCTTTAAA
ATAATATCTTTAAGAATTTATGAGTAAATTAAGAAAGATCCAAAAAGATTTTATTTTCTC
TTATTAGAGTTTATAACTTACTCAAAGATAACTCTTAATTAATTGTTTTTTATGTGTAAA
TTAAATTTAAATTAGACAACATTTTAAGAAGAAAGTATTGAAAAATACTGTTGGTTTGCT
AGATGTTTGCTTGAAGGTTAGGTCTTAGATTTCTTCAAAGCATGCAAGAGCCTCTATTAA
TTTGATCCTCAGATAATAAAATCATCTAATTTATAACCTAAAGTTTAAGCAATCGTTAAT
AAGCTTAAAAACAATCAAATTGATAATTCTCAAAAGCTAGTTAAAAAGTGGGAGTCAGAT
AAATCGTAAAATCTTTAATTAAATTTATTATTTTGTGATATTATTGTAATTTATAATAAA
ATAGTTTCTTACTTCCTGAAGTTGCTTTGTGGATAAAAGATTAATATAAAGCTAATATAT
AGAAGAAATGGCCTCCTACTTCTTGA