Identifiers and Description

Gene Model Identifier

TTHERM_01044780

Standard Name

DRH24 (DExD/H box RNA helicase 24)

Aliases

PreTt05927 | 209.m00064 | 3760.m00252

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01044780

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_90950
WormBaseWBGene000189679.997093137033517e-262locus:ddx-15 Putative pre-mR
NA-splicing factor ATP-depende
nt RNA helicase F56D2.6 stat
us:Confirmed UniProt:Q20875
protein_id:CCD63138.1
Tetrahymena borealisEI9_20387.19.997093137033517e-262helicase associated domain (HA
2) (744 aa)
DictyBaseDDB_G02852139.997093137033517e-262dhx15 on chromosome: 4 positio
n 2984261 to 2986444
OxytrichaContig12082.0.g389.997093137033517e-262Helicase associated domain (HA
2)
SGDYGL120C9.997093137033517e-262PRP43 RNA helicase in the DEAH
-box family, functions in both
RNA polymerase I and polymera
se II transcript metabolism, i
nvolved in release of the lari
at-intron from the spliceosome

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000091

Sequences

>TTHERM_01044780(coding)
ATGGGATCACCAGATAAAAAATCAAAATAAGAAAAAAAGTCGAAGTTTACTGAGTAGGAA
GACTAAAAATCTGCTTTACATGATGACAACATTATTGTTGGATCTAGTAAAAGAAAGGGA
ATAGATATGAGTAAATTTTCAGCTGAATAAGGCGACGATGACGGTGCTGATCCTTCAAAG
AAGATCAGAGTTTCAATGAATCCTTGGACTAATAAAGTCTATTCTAAGAAGTATTATGAA
ATTCTTAAGACCAGACAATCTCTTCCTGCTTGGGAGGCTAAAGGATAGCTCTTGAAGCTC
CTTGATGAAAATTAAGTTATTGTTTTATAGGGTGAGACAGGTTCTGGTAAAACTACACAA
ATCCCTCAATTCTTGTTGGAATCAAAGCATGTCAAAGGCAAAAAAGGTATCTGTTGTACT
CAACCCAGAAGAGTTGCTGCTATGTCTGTAGCAAAGAGAGTTGCAGATGAAATGGATGTT
CAATTAGGTGATGAAGTTGGTTATTCAATTCGTTTTGAAGATAAAACATCAAATAAAACT
ATGTTAAAATATCTAACTGATGGTATGTTGCTCAGAGAAGCCATCCATGATCCTCTTTTA
GAAAAATACAGCATAATTATGCTCGATGAAGCTCACGAAAGAACATTGAATACTGATATA
TTATTTGGTCTACTTAAAGAAATTCTTGAAAACAGAAAGGATCTCAAGATTGTTGTTATG
AGTGCTACAATGGATGCTGAAAAGTTTTAAGGTTACTTTAAGGATGCCCCATTACTTGAA
ATTCCAGGTCGTTTATATCCTGTCGAAATCTTTTACACACATGAACCAGAAAAAGACTAT
GTTGAAGCTGCTATTAGAACTGCAGTATAGATTCATATGTATGAAGACGAAGGAGATATG
TTAGTTTTCTTAACAGGTGAAGAGGAAATTGAAAATGCATGCAAGCAAATTAAGCAAGAA
ATTTAAAAATAAGGTGATACTTGTGGACCTGTTAATGTTATTCCTCTTTACAGTTCATTG
CCACCCGCTATGCAATAAAAAATCTTCGATCCTGCTCCAGGCCCTAATAAAAAAGGTATT
CCTGGAAGAAAAATCATCGTTGCAACAAATATTGCTGAAACTTCTTTAACAATTGATGGT
ATTGTTTACGTTATCGATCCAGGTTTTGCTAAATAGAAAGTATTCAATCCTCGTATGAGA
GTTGAATCACTTCTTGTTTCTCCAATTTCTAAGGCTTCAGCAAAATAAAGAGCTGGTAGA
GCTGGTAGAACCCGTCCTGGTAAATGCTTCCGTCTCTACACTGAAGCTTCTTTTAAAAAT
GAATTGATGGAAGACACTTATCCTGAAATTCTTAGATCTAATTTGGCTTCAGTTGTTCTT
ACTTTAAAAAAGCTTGGTATTAATGATTTGGTACACTTCGATTTTATGGATCCTCCTGCT
CCTGAAACTTTAATGCGTGCATTAGAACTTCTTAATGATTTAGGTGCTTTAGATGATGAA
GGTGAACTCACTAAAATTGGTGAAATGATGGCTGAATTCCCTCTTGAACCTTAATTAGGA
AAGATTCTTTTAAATTCAGCAAAGTATTAATGTTCAGAAGAAATGGTTAGTATTGTAGCT
TTACTTAGTGTCCCAAATATATTCTCGAGACCTAAGGAAAACCAAAAAGAAGCTGATGAT
GCTAGACTAAAGTTCTGCAATCCCGATGGCGATCATCTTACCATGCTTAATGCATATAAC
GCTTATAAGTAAAAGAAAGAAAATGCTGAATGGTGCAAAAGCAATTATTTAAATAGTCGT
TCTTTAAAGTCCGCAGACGATGTTAGAGAATAACTAAAGAATTTGATGGTAAAACTCGAA
ATTCCTCTTGTATCATGTGGTACTAATTATGAAAATGTTAAAAAGTGTCTTCTTAGTGGA
TTTTTCATGTAAGTTGCAAAATTATAGAGAAACGGTGCTTATATGGCATTTAAGGATGTT
CAAACTGTTGCTATTCACCCTTCTTCTGTTGTTGATTAAAAGCCTGATTGGGTTATATAT
AATGAATTCGTTTTAACAAAGCGTCATTATATTAGAAATATAACAGCTATAAAAGGAGAA
TATTTGTTCGAAGTAAACCCTGATTATTTCAATCCTGCTAGAATAAAACATATTGATACT
CGTAAAGACTTAGAAAAATTAGAAAAGGAAATGATAGAAAAACGTAAAAAATAATCTCAA
CAAAGTTCAAAATGA


>TTHERM_01044780(protein)
MGSPDKKSKQEKKSKFTEQEDQKSALHDDNIIVGSSKRKGIDMSKFSAEQGDDDGADPSK
KIRVSMNPWTNKVYSKKYYEILKTRQSLPAWEAKGQLLKLLDENQVIVLQGETGSGKTTQ
IPQFLLESKHVKGKKGICCTQPRRVAAMSVAKRVADEMDVQLGDEVGYSIRFEDKTSNKT
MLKYLTDGMLLREAIHDPLLEKYSIIMLDEAHERTLNTDILFGLLKEILENRKDLKIVVM
SATMDAEKFQGYFKDAPLLEIPGRLYPVEIFYTHEPEKDYVEAAIRTAVQIHMYEDEGDM
LVFLTGEEEIENACKQIKQEIQKQGDTCGPVNVIPLYSSLPPAMQQKIFDPAPGPNKKGI
PGRKIIVATNIAETSLTIDGIVYVIDPGFAKQKVFNPRMRVESLLVSPISKASAKQRAGR
AGRTRPGKCFRLYTEASFKNELMEDTYPEILRSNLASVVLTLKKLGINDLVHFDFMDPPA
PETLMRALELLNDLGALDDEGELTKIGEMMAEFPLEPQLGKILLNSAKYQCSEEMVSIVA
LLSVPNIFSRPKENQKEADDARLKFCNPDGDHLTMLNAYNAYKQKKENAEWCKSNYLNSR
SLKSADDVREQLKNLMVKLEIPLVSCGTNYENVKKCLLSGFFMQVAKLQRNGAYMAFKDV
QTVAIHPSSVVDQKPDWVIYNEFVLTKRHYIRNITAIKGEYLFEVNPDYFNPARIKHIDT
RKDLEKLEKEMIEKRKKQSQQSSK


>TTHERM_01044780(gene)
ATGGGATCACCAGATAAAAAATCAAAATAAGAAAAAAAGTCGAAGTTTACTGAGTAGGAA
GACTAAAAATCTGCTTTACATGATGACAACATTATTGTTGGATCTAGTAAAAGAAAGGGA
ATAGATATGAGTAAATTTTCAGCTGAATAAGGCGACGATGACGGTGCTGATCCTTCAAAG
AAGATCAGAGTTTCAATGAATCCTTGGACTAATAAAGTCTATTCTAAGAAGTATTATGAA
ATTCTTAAGACCAGACAATCTCTTCCTGCTTGGGAGGCTAAAGGATAGCTCTTGAAGCTC
CTTGATGAAAATTAAGTTATTGTTTTATAGGGTGAGACAGGTTCTGGTAAAACTACACAA
ATCCCTCAATTCTTGTTGGAATCAAAGCATGTCAAAGGGTAATAATATATAAATTTTTAC
ATTTGATTATCCTTTTCACCTTTTGGTATTGAAATTAGGAAAACATGCTTTTAGTATGTT
TGTGGGACATAATAAAAAATTATTATAAAAACATAAAAATTATTTAAATAAGAATTCAAA
ATTATTTTAGAGGGATATTTTTTGAATTTACTTTATATTCAAATTAACATTTACTGCATT
TTTAAATTTTGAGAAATTAACAATATTATGTTTATGAAATAGCAAAAAAGGTATCTGTTG
TACTCAACCCAGAAGAGTTGCTGCTATGTCTGTAGCAAAGAGAGTTGCAGATGAAATGGT
AAATATTTGGAATTAAAAAAATTGACTTATTTAATTCTTTTTGCTTTTTTCAAAAGGATG
TTCAATTAGGTGATGAAGTTGGTTATTCAATTCGTTTTGAAGATAAAACATCAAATAAAA
CTATGTTAAAATATCTAACTGATGGTATGTTGCTCAGAGAAGCCATCCATGATCCTCTTT
TAGAAAAATACAGCATAATTATGCTCGATGAAGCTCACGAAAGAACATTGAATACTGATA
TATTATTTGGTCTACTTAAAGAAATTCTTGAAAACAGAAAGGATCTCAAGATTGTTGTTA
TGAGTGCTACAATGGATGCTGAAAAGTTTTAAGGTTACTTTAAGGATGCCCCATTACTTG
AAATTCCAGGTCGTTTATATCCTGTCGAAATCTTTTACACACATGAACCAGAAAAAGACT
ATGTTGAAGCTGCTATTAGAACTGCAGTATAGATTCATATGTATGAAGACGAAGGAGATA
TGTTAGTTTTCTTAACAGGTGAAGAGGTAATTAATTATCACAATTATAAATAAATGAATT
ATTTAAATCGAATTATATATAGATAATTTAGTTTTGATTTTATACAAAAAACTAGCTATT
AGAGAGAAGGTTTAAGTTTTTAAATAAAATACTCCTTCATTTATTTTTGGAAATAAAAAT
AAAAGATAAATAAATAAATAAATTATCAAATTTGCCTAAAAGATTTGTTTTCAAATTTAA
AATAGATTGATTGATGATAGTTTAATATAAAAGAATAAATAGCTAAATATTCTAAGTTAG
TCTCAATAATTTTAAATATAACTTTCCCATTTAAAAAATAGGAAATTGAAAATGCATGCA
AGCAAATTAAGCAAGAAATTTAAAAATAAGGTGATACTTGTGGACCTGTTAATGTTATTC
CTCTTTACAGTTCATTGCCACCCGCTATGCAATAAAAAATCTTCGATCCTGCTCCAGGCC
CTAATAAAAAAGGTATTCCTGGAAGAAAAATCATCGTTGCAACAAATATTGCTGAAACTT
CTTTAACAATTGATGGTATTGTTTACGTTATCGATCCAGGTTTTGCTAAATAGAAAGTAT
TCAATCCTCGTATGAGAGTTGAATCACTTCTTGTTTCTCCAATTTCTAAGGCTTCAGCAA
AATAAAGAGCTGGTAGAGCTGGTAGAACCCGTCCTGGTAAATGCTTCCGTCTCTACACTG
AAGCTTCTTTTAAAAATGAATTGATGGAAGACACTTATCCTGAAATTCTTAGATCTAATT
TGGCTTCAGTTGTTCTTACTTTAAAAAAGCTTGGTATTAATGATTTGGTACACTTCGATT
TTATGGATCCTCCTGCTCCTGAAACTTTAATGCGTGCATTAGAACTTCTTAATGATTTAG
GTGCTTTAGATGATGAAGGTGAACTCACTAAAATTGGTGAAATGGTAAATAAATATTAAA
ATAAAATTTAAAATCTTCTTTATAACATTAAGCTATTTCACTTAATTAATTAATTCTTTT
GTAAAAATATAGATGGCTGAATTCCCTCTTGAACCTTAATTAGGAAAGATTCTTTTAAAT
TCAGCAAAGTATTAATGTTCAGAAGAAATGGTTAGTATTGTAGCTTTACTTAGTGTCCCA
AATATATTCTCGAGACCTAAGGAAAACCAAAAAGAAGCTGATGATGCTAGACTAAAGTTC
TGCAATCCCGATGGCGATCATCTTACCATGCTTAATGCATATAACGCTTATAAGTAAAAG
AAAGAAAATGCTGAATGGTGCAAAAGCAATTATTTAAATAGTCGTTCTTTAAAGTCCGCA
GACGATGTTAGAGAATAACTAAAGAATTTGATGGTAAAACTCGAAATTCCTCTTGTATCA
TGTGGTACTAATTATGAAAATGTTAAAAAGTGTCTTCTTAGTGGATTTTTCATGTAAGTT
GCAAAATTATAGAGAAACGGTGCTTATATGGCATTTAAGGATGTTCAAACTGTTGCTATT
CACCCTTCTTCTGTTGTTGATTAAAAGCCTGATTGGGTTATATATAATGAATTCGTTTTA
ACAAAGCGTCATTATATTAGAAATATAACAGCTATAAAAGGAGAATATTTGTTCGAAGTA
AACCCTGATTATTTCAATCCTGCTAGAATAAAACATATTGATACTCGTAAAGACTTAGAA
AAATTAGAAAAGGAAATGATAGAAAAACGTAAAAAATAATCTCAACAAAGTTCAAAATGA