Identifiers and Description

Gene Model Identifier

TTHERM_00120930

Standard Name

DRH23 (DExD/H box RNA helicase 23)

Aliases

PreTt27207 | 8.m00467 | 3812.m02496

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00120930

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_351220
Tetrahymena borealisEI9_03850.19.997093137033517e-262hypothetical protein (809 aa)
OxytrichaContig10731.0.g699.997093137033517e-262Oligonucleotide/oligosaccharid
e-binding (OB)-fold
DictyBaseDDB_G02693063.0003580931682248e-179dhx35 on chromosome: 1 positio
n 2485989 to 2488139
WormBaseWBGene000033922.998539800509618e-166locus:mog-4 Probable pre-mRN
A-splicing factor ATP-dependen
t RNA helicase mog-4 status:
Confirmed UniProt:O45244 p
rotein_id:CAB03845.1
SGDYGL120C3.000455015819344e-150PRP43 RNA helicase in the DEAH
-box family, functions in both
RNA polymerase I and polymera
se II transcript metabolism, i
nvolved in release of the lari
at-intron from the spliceosome

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00120930(coding)
ATGAGGACATTTGAGTTTAAAAAGAAGCAGTTTGGCAATAACTAAGCAAATAGTCAAGAA
TAGTAGAAATAATAGTGGCAGGAGATTTAGAAATAAAAGAAATAAAGAAAAGAAGAAGAC
ATTTTAGTTGGAGAGAGAGGTGGTTTCTAGGGTTTTGATTAATGGGACTTTAAAGAATTG
CCTATTGTATAGCACAAATAAGAGATTTTATATTGCGTAGAAAACTATTCTTGTGTGGTT
GTAATTGCAGAAACAGGCTCAGGAAAAACAACAAAAATTCCTCAGTATTTGGTAGAAGCA
GGATATGCTATAAATGGTAAAAAAATTGGGGTCAGTTAACCTAGAAGGATTGCAGCGATC
AGTATTGCAAATAGAGTTGCTCAAGAAATGGGTTGTATTATTGGTTAAGAAGTTGGGTAT
AGTGTGAGATTCGATGATAATTGTGATGAGGAGCTCACTTAAATCAAATACATGACAGAT
GGTATGCTTATAAATTAAATTCTTAATGATCCCTTATTAAGTGAATACTCAGTGCTAATG
ATTGATGATATTCATGAAAGAAGTATAAACACTGATATCTTGTTAGGATTGTTAAAAAAA
ATCAGAAGAAAGAATCCACAGCTGAAATTAGTTATTTCTAGTGCTACTATTGATGCTGAA
AGTATTAGCACCTTTTTCTAGGAAAGAGTAACAGATCCTAAAACAAATTAGGTTATTGCT
AACCTCACTTCGTAAATTTTGTACATAGAAGGCAGACAATTTCCTGTAGATATTTATTAC
CTTAAAGAAACTACAAGAAATTATGTTGTGAAAGCCGTATAAGTCACTCTTGAAATCATA
AGAGCTCCTGATAAAAAGGGAGATATCTTAATCTTTTTGACTGGTTAAGAAGAAATAGAA
GCCTTTATCGAAATCATTTAAAAAAATTTTATTGGGGATGCTGAAAGATAAAATTTGAAA
ATACTTCCACTTTACTCTGGATTGCCTCTAGAGGACTAAATGGAGGTTTTTAAACCAAGT
GAATCATATGTTAGAAAAATTATAGTCTCAACTAACATTGCTGAGTCCAGTATCACTATT
AGTGGAGTAGTTTATGTTATAGATACCCTTTTTCACAAAATAAATTATTATGATTTTAAA
AGAGGGTTTGAAAACCTTCTTGTTGTACCGATAAGCAAAGCTGCTGCTAAATAAAGAGCT
GGAAGAGCTGGCAGAGTATAAAGAGGTGAATGCTATAGATTATGCACAAAAGATTAGTTT
GTACAATTATACGATAACAGCACTCCAGAGATATTAAGATGTGATTTATCAACTTTCATT
CTCTAGTTAAAAACACTTGGAGTAGGAGATGTCACTAACTTTGAATTACTTTAGTAGCCT
AACGAAAATGCGTATGCAAAAGCATTAGAATAACTATTTGCTTTAAAGGTTATAGATAAA
TATTGCAATCTTACTTAAGAAATTGGACATAAAATATGTGATTTTAATCTTGAAACTAAG
TTAGGAGTTCTATTATTGAATAGCTTTAAAGATGATTTTGGATGTAGTTAACAAATGCTT
GTTTTATGTTCAATGCTCAGCTTGTAAGGTTAGGTATTTTACAATGGATTTGATCCAGCT
ACTATTTTGAAATAAAAGAAAAAATTAGGAGCTAAAGAAGGTGATCATATTACATTAATC
AATATATTTTTAGCCTTTAATCACCTGAAAAGCTCACAAGCTAGACAAGGATTTTGTAGC
GATCACAAACTAAATATAAAAAGCCTAAATATGGCAGTTAAAATACATGATTAGCTTTGC
AAATAAGTTAAAAGAATGGGATTGAAGGTTAACAATAGTGAAGATGATATTGAGGGAATT
TTGAGAGCTTTAGTTACAGCTTTCTTTATGAATGTTGCACAACTTTAACCTGATGGATCT
TATAGAAATTTAAGAAATAAAGAAATTCTTTATCTTCACCCTACTTCAATACTTAACATA
AATTTTCCTCAATGGGTCATATATTCTGAAGTTGTATTTTCAACAAAGTATTACATGAGA
GAAGTTTCTGAAGTAGATCCAAAATGGTTGCTTGAATTAGCCAGCCATTATTTCGAAGAT
CAGAGATTAAAGTAAGCTGAGTAAAAGCATGGTAAAGAAATCATAGCACAAAATGAATAT
GAAAAAAACAAATAAAAAATTGAAGAAGAAAAATAAAAGGATCCAGTCATGGGTAGATTT
AATATATTTAAAAGAAAAAGGCCTACAAATGTTATAGGTAGAGATGATGATAAAGAAAAA
GAAGGATAGGAAAAGCTATAGAAAAAGCTAAAAATTAATCTACCACCCTCAAAACCTCAA
AATACAAATTTATTATCATTTCAACAAGATGATGAAGAGGAAGAAGAGTATAATATAGAA
GAAAGTGACGAAGACAATAATATTAAAGAAAATGAATGA


>TTHERM_00120930(protein)
MRTFEFKKKQFGNNQANSQEQQKQQWQEIQKQKKQRKEEDILVGERGGFQGFDQWDFKEL
PIVQHKQEILYCVENYSCVVVIAETGSGKTTKIPQYLVEAGYAINGKKIGVSQPRRIAAI
SIANRVAQEMGCIIGQEVGYSVRFDDNCDEELTQIKYMTDGMLINQILNDPLLSEYSVLM
IDDIHERSINTDILLGLLKKIRRKNPQLKLVISSATIDAESISTFFQERVTDPKTNQVIA
NLTSQILYIEGRQFPVDIYYLKETTRNYVVKAVQVTLEIIRAPDKKGDILIFLTGQEEIE
AFIEIIQKNFIGDAERQNLKILPLYSGLPLEDQMEVFKPSESYVRKIIVSTNIAESSITI
SGVVYVIDTLFHKINYYDFKRGFENLLVVPISKAAAKQRAGRAGRVQRGECYRLCTKDQF
VQLYDNSTPEILRCDLSTFILQLKTLGVGDVTNFELLQQPNENAYAKALEQLFALKVIDK
YCNLTQEIGHKICDFNLETKLGVLLLNSFKDDFGCSQQMLVLCSMLSLQGQVFYNGFDPA
TILKQKKKLGAKEGDHITLINIFLAFNHLKSSQARQGFCSDHKLNIKSLNMAVKIHDQLC
KQVKRMGLKVNNSEDDIEGILRALVTAFFMNVAQLQPDGSYRNLRNKEILYLHPTSILNI
NFPQWVIYSEVVFSTKYYMREVSEVDPKWLLELASHYFEDQRLKQAEQKHGKEIIAQNEY
EKNKQKIEEEKQKDPVMGRFNIFKRKRPTNVIGRDDDKEKEGQEKLQKKLKINLPPSKPQ
NTNLLSFQQDDEEEEEYNIEESDEDNNIKENE


>TTHERM_00120930(gene)
ATGAGGACATTTGAGTTTAAAAAGAAGCAGTTTGGCAATAACTAAGCAAATAGTCAAGAA
TAGTAGAAATAATAGTGGCAGGAGATTTAGAAATAAAAGAAATAAAGAAAAGAAGAAGAC
ATTTTAGTTGGAGAGAGAGGTGGTTTCTAGGGTTTTGATTAATGGGACTTTAAAGAATTG
CCTATTGTATAGCACAGTAAATAAAAATAATTATTTTTCTTTTAAATAAACAAAAAATGT
ATTTTAATAGAATAAGAGATTTTATATTGCGTAGAAAACTATTCTTGTGTGGTTGTAATT
GCAGAAACAGGCTCAGGAAAAACAACAAGTAAGTAATTAATTGATCATTTGATTTACAAT
TCACTTTTAGACATAATTAGTTATAAAATATTTCAAATTAAGCACATCAAAATAAAAAAT
ACAAAAATATTCACTTTGAGAAGGCTCAAAACTTGTTTTTGATATGGCTTATTTTATCTT
GAAAAGTTAATCCATTATTTTACATTATTTTTTAAATTTATTTTTATGTTAGAAATTCCT
CAGTATTTGGTAGAAGCAGGATATGCTATAAATGGTAAAAAAATTGGGGTCAGTTAACCT
AGAAGGATTGCAGCGATCAGTATTGCAAATAGAGTTGCTCAAGAAATGGGTTGTATTATT
GGTTAAGAAGTTGGGTATAGTGTGAGATTCGATGATAATTGTGATGAGGAGCTCACTTAA
ATCAAATACATGACAGATGGTATGCTTATAAATTAAATTCTTAATGATCCCTTATTAAGT
GAATACTCAGTGCTAATGATTGATGATATTCATGAAAGAAGTATAAACACTGATATCTTG
TTAGGATTGTTAAAAAAAATCAGAAGAAAGAATCCACAGCTGAAATTAGTTATTTCTAGT
GCTACTATTGATGCTGAAAGTATTAGCACCTTTTTCTAGGAAAGAGTAACAGATCCTAAA
ACAAATTAGGTTATTGCTAACCTCACTTCGTAAATTTTGTACATAGAAGGCAGACAATTT
CCTGTAGATATTTATTACCTTAAAGAAACTACAAGAAATTATGTTGTGAAAGCCGTATAA
GTCACTCTTGAAATCATAAGAGCTCCTGATAAAAAGGTTTATTTTATTTGAAAATATGAA
AATATTTTAATAATTGTTTGAAAATAAATATGTTCAGGGAGATATCTTAATCTTTTTGAC
TGGTTAAGAAGAAATAGAAGCCTTTATCGAAATCATTTAAAAAAATTTTATTGGGGATGC
TGAAAGATAAAATTTGAAAATACTTCCACTTTACTCTGGATTGCCTCTAGAGGACTAAAT
GGAGGTTTTTAAACCAAGTGAATCATATGTTAGAAAAATTATAGTCTCAACTAACATTGC
TGAGTCCAGTATCACTATTAGTGGAGTAGTTTATGTTATAGATACCCTTTTTCACAAAAT
AAATTATTATGATTTTAAAAGAGGGTTTGAAAACCTTCTTGTTGTACCGATAAGCAAAGC
TGCTGCTAAATAAAGAGCTGGAAGAGCTGGCAGAGTATAAAGAGGTGAATGCTATAGATT
ATGCACAAAAGATTAGTTTGTACAATTATACGATAACAGCACTCCAGAGATATTAAGATG
TGATTTATCAACTTTCATTCTCTAGTTAAAAACACTTGGAGTAGGAGATGTCACTAACTT
TGAATTACTTTAGTAGCCTAACGAAAATGCGTATGCAAAAGCATTAGAATAACTATTTGC
TTTAAAGGTTATAGATAAATATTGCAATCTTACTTAAGAAATTGGACATAAAATATGTGA
TTTTAATCTTGAAACTAAGTTAGGAGTAAATTAATTTATTAAAAATCCTTTTCAAAATTT
AAAATATTCATAAATAGTAAAAAATAAATAAGTCATTTATTTTTATTTTATTAACATAAA
GGTTCTATTATTGAATAGCTTTAAAGATGATTTTGGATGTAGTTAACAAATGCTTGTTTT
ATGTTCAATGCTCAGCTTGTAAGGTTAGGTATTTTACAATGGATTTGATCCAGCTACTAT
TTTGAAATAAAAGAAAAAATTAGGAGCTAAAGAAGGTGATCATATTACATTAATCAATAT
ATTTTTAGCCTTTAATCACCTGAAAAGCTCACAAGCTAGACAAGGATTTTGTAGCGATCA
CAAACTAAATATAAAAAGCCTAAATATGGCAGTTAAAATACATGATTAGCTTTGCAAATA
AGTTAAAAGAATGGGATTGAAGGTTAACAATAGTGAAGATGATATTGAGGGAATTTTGAG
AGCTTTAGTTACAGCTTTCTTTATGAATGTTGCACAACTTTAACCTGATGGATCTTATAG
AAATTTAAGAAATAAAGAAATTCTTTATCTTCACCCTACTTCAATACTTAACATAAATTT
TCCTCAATGGGTCATATATTCTGAAGTTGTATTTTCAACAAAGTATTACATGAGAGAAGT
TTCTGAAGTAGATCCAAAATGGTTGCTTGAATTAGCCAGCCATTATTTCGAAGATCAGAG
ATTAAAGTAAGCTGAGTAAAAGCATGGTAAAGAAATCATAGCACAAAATGAATATGAAAA
AAACAAATAAAAAATTGAAGAAGAAAAATAAAAGGATCCAGTCATGGGTAGATTTAATAT
ATTTAAAAGAAAAAGGCCTACAAATGTTATAGGTAGAGATGATGATAAAGAAAAAGAAGG
ATAGGAAAAGCTATAGAAAAAGCTAAAAATTAATCTACCACCCTCAAAACCTCAAAATAC
AAATTTATTATCATTTCAACAAGATGATGAAGAGGAAGAAGAGTATAATATAGAAGAAAG
TGACGAAGACAATAATATTAAAGAAAATGAATGA