Identifiers and Description

Gene Model Identifier

TTHERM_00112510

Standard Name

DRH22 (DExD/H box RNA helicase 22)

Aliases

PreTt27065 | 8.m00325 | 3812.m02362

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00112510

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03964.19.997093137033517e-262hypothetical protein (706 aa)
DictyBaseDDB_G02701102.0009356157506544e-160dhx33 on chromosome: 1 positio
n 4244035 to 4246332
OxytrichaContig3639.0.g112.0005951135209932e-158Oligonucleotide/oligosaccharid
e-binding (OB)-fold
WormBaseWBGene000033932.0007442334946695e-153locus:mog-5 Probable pre-mRN
A-splicing factor ATP-dependen
t RNA helicase mog-5 status:
Confirmed UniProt:Q09530 p
rotein_id:CCD68732.1
SGDYGL120C2.0004037638327014e-151PRP43 RNA helicase in the DEAH
-box family, functions in both
RNA polymerase I and polymera
se II transcript metabolism, i
nvolved in release of the lari
at-intron from the spliceosome
Stentor CoeruleusSteCoe_231714.408531331463226e-71

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00112510(coding)
ATGGAAATTGAGAAAAGCTAATCACCTAATAAAAGCACTGTATAGCAGTAAATATTAGTA
GAAAAAAACAAAAATGGCAATTTGGGGTTATTTAATAAGCTCTAAAAAGAAAGAAAGAAC
CTTCCTATATTCAAGCACAGATAAGGTTTATTGGATAAAATAAAAAGCAATTAAATTAGT
GTTATTGCTGGTGAAACTGGTTGTGGTAAGACAACTTAAATTCCTCAATATTTAATTGAA
GAGGGTTTAAACAAGAACAGAATGATTGCCGTTACACAGCCTAGAAGAGTTGCAGCTATT
ACTATAGCATAAAGAGTTGCTTAGGAAATGAATACTACTGTTGGTAATAAAGTTGGTTAC
AGTGTTAGATTTGAGGAAGCTGTTGATAAAAATAATACAAAATTATTATATATGACTGAT
GGTATGCTTTTAAGAGAAACTATCGTTGACCCTAATCTTTCTAGATTTTCAATAATTGTT
ATTGATGAAGCTCACGAAAGAACTATAAATTCAGATTTACTTATATCTCTGCTTAAATAG
CTGTCAGAAAGAAGAAAGGATCTTAAAATTATAATTATGTCTGCAACAATAGAAACTGAA
AAATTTGCAAACTTCTTTGAAACAGAAAATATTATATATTTAGAAGGTAGATGCCATCCA
ATTGAAGTATTCTATTCAAAAAAGCCACATGCAGATTACTTAGATGCTGCTTTAAACACA
ATATTACAAATTCACTTCGAAGAATAAGATGGAGATATTTTATGCTTTTTAGTAGGACAA
GAAGACATAGAAGACATGCAACAAATGCTAGAAGAAAAGATAGAGCTTTTCCCTAAAGAG
GCAAAAAAGCTAAACATTTGCACTCTCTATGCTGCTTTACCTTCACATTTACAATTATTA
GCATTTGAAAAAAGCTAAGAAGGTGAAAGAAAAGTAGTTTTATCTACTAATATTGCTGAA
ACTTCAGTTACCATTGATGGTATAAAATATGTTGTTGATCCTGGTTTAGTTAAGACAAGG
AAGTATAACCCAAATAAATTAATAGAAATGCTTTTAGTTGTACCCGTTTCTAAATCTTCA
GCTATGCAGAGGGCTGGTAGAGCAGGTAGATAATCTGCAGGTAAATGCTTTAGGCTCTAC
ACCAAATATACTCATGACACCTTGGCTGAATTTATGTTACCTGAAATTCTCAGATCAAAT
CTTTCAACAGTTATTTTGCAAATGAAAGCTATTGGAATTAAAGATGTTAAAGGATTCTAG
TTTATAGATAGACCACATGAAGACTAATTCATAGAAAGTATTGAAAACCTTTAACAGATG
AACGCTTTAGATGCTAATGAAAATATTACTTTGCATGGTAAGGAAATGGCTGAATTACCT
CTTGAACCAATATATGCTCATTTTATGCTTGTAGCTTTTGCTACTAATCCTAACTCGATT
AGTGTTGTTCTTTCAGCAATCAGTTTGATGCAAGTAGAAAATCTCTTTTTCATTCCTAAG
GGTGCAAAAATATCTTTATTAGATGTTTTACTTAGGTTTTAGTTAGGAAATAGTGATTAA
TTGACAAAGGTCAACATGCTGCACTAATATTATCTAGCAAAAAATAAAAAGAGTTTTTGT
AAAGAAAATTTCATTAATCAAAAAAATATAAAGAAAGCTTTGGAAGTAAGATAATAATTA
GAAAATTACTTCCTTGATATTCTTAAGAAGAGATCTAAAAAGAATTAAAAGTAAAACTAA
GCAAATATCTAATAGCAAAGTGAAGAGTAGTAAATTTAAGAAGAATTAGCAAAAGGAAAT
ACATTAAAAAAATTGTAAGAAGAACATAAAACAGCTATTTAATAGGAAATAAATACAGAA
GAGTTTATATCATGTATTGCTAAAGGATTATCTGTGAAAGCTGCCAAGCTAAATAACGAT
GGAACTTATACTATTATTAGAAGCAATATTCAAGCTTACATTCACCCTGAGAGTTTGCTG
TTTTACTCAAAGCCTAAACCTGATTATATCATTTTCAATGAAGTTGTTAGTACTATAAAA
ACGTATCTTAGAGACATTACTGAAATATCATTCTCTGATTTTAAAGAAATTTCTAAATGA


>TTHERM_00112510(protein)
MEIEKSQSPNKSTVQQQILVEKNKNGNLGLFNKLQKERKNLPIFKHRQGLLDKIKSNQIS
VIAGETGCGKTTQIPQYLIEEGLNKNRMIAVTQPRRVAAITIAQRVAQEMNTTVGNKVGY
SVRFEEAVDKNNTKLLYMTDGMLLRETIVDPNLSRFSIIVIDEAHERTINSDLLISLLKQ
LSERRKDLKIIIMSATIETEKFANFFETENIIYLEGRCHPIEVFYSKKPHADYLDAALNT
ILQIHFEEQDGDILCFLVGQEDIEDMQQMLEEKIELFPKEAKKLNICTLYAALPSHLQLL
AFEKSQEGERKVVLSTNIAETSVTIDGIKYVVDPGLVKTRKYNPNKLIEMLLVVPVSKSS
AMQRAGRAGRQSAGKCFRLYTKYTHDTLAEFMLPEILRSNLSTVILQMKAIGIKDVKGFQ
FIDRPHEDQFIESIENLQQMNALDANENITLHGKEMAELPLEPIYAHFMLVAFATNPNSI
SVVLSAISLMQVENLFFIPKGAKISLLDVLLRFQLGNSDQLTKVNMLHQYYLAKNKKSFC
KENFINQKNIKKALEVRQQLENYFLDILKKRSKKNQKQNQANIQQQSEEQQIQEELAKGN
TLKKLQEEHKTAIQQEINTEEFISCIAKGLSVKAAKLNNDGTYTIIRSNIQAYIHPESLL
FYSKPKPDYIIFNEVVSTIKTYLRDITEISFSDFKEISK


>TTHERM_00112510(gene)
ATGGAAATTGAGAAAAGCTAATCACCTAATAAAAGCACTGTATAGCAGTAAATATTAGTA
GAAAAAAACAAAAATGGCAATTTGGGGTTATTTAATAAGCTCTAAAAAGAAAGAAAGAAC
CTTCCTATATTCAAGCACAGATAAGGTTTATTGGATAAAGTAATAAATTTTAAATGCTAT
TAATGAAAGCTTTCTATGAGATATACTTCATACAATTTATTCAAACTATGCTTTTAGTAA
ATAATATGTTTTAATTTTAGATAAAAAGCAATTAAATTAGTGTTATTGCTGGTGAAACTG
GTTGTGGTAAGACAACTTAAATTCCTCAATATTTAATTGAAGAGGGTTTAAACAAGAACA
GAATGATTGCCGTTACACAGCCTAGAAGAGTTGCAGCTATTACTATAGCATAAAGAGTTG
CTTAGGAAATGAATACTACTGTTGGTAATAAAGTTGGTTACAGTGTTAGATTTGAGGAAG
CTGTTGATAAAAATAATACAAAATTATTATATATGACTGATGGTATGCTTTTAAGAGAAA
CTATCGTTGACCCTAATCTTTCTAGATTTTCAATAATTGTTATTGATGAAGCTCACGAAA
GAACTATAAATTCAGATTTACTTATGTAATTAATGGATTATCAAATAGCTAAATTAATGA
ATCTAAATAGCCTAATTATTAATATTTTTTTATTTATATGATGTTAGATCTCTGCTTAAA
TAGCTGTCAGAAAGAAGAAAGGATCTTAAAATTATAATTATGTCTGCAACAATAGAAACT
GAAAAATTTGCAAACTTCTTTGAAACAGAAAATGTAACATAATAAATCTTAATAAATGAA
GACAAATGAAATGAATTTTATTTTAATAGATTATATATTTAGAAGGTAGATGCCATCCAA
TTGAAGTATTCTATTCAAAAAAGCCACATGCAGATTACTTAGTAAAGAATAAAATTTTAT
AGTAAGAGATAAATAAATATTTGTATTTATTTATACTAATAGGATGCTGCTTTAAACACA
ATATTACAAATTCACTTCGAAGAATAAGATGGAGATATTTTATGCTTTTTAGTAGGACAA
GTAGGTTTATTTAGTTTTAAACTAATAGATTTGATATTTTATATTTTTAAAGGAAGACAT
AGAAGACATGCAACAAATGCTAGAAGAAAAGATAGAGCTTTTCCCTAAAGAGGCAAAAAA
GCTAAACATTTGCACTCTCTATGCTGCTTTACCTTCACATTTACAATTATTAGCATTTGA
AAAAAGCTAAGAAGGTGAAAGAAAAGTAGTTTTATCTACTAATATTGCTGAAACTTCAGT
TACCATTGATGGTAAAGCAAAATTCTATATAAAGCTTAATATTTATTTAATATTAAATAA
TTTATTTTAGGTATAAAATATGTTGTTGATCCTGGTTTAGTTAAGACAAGGAAGTATAAC
CCAAATAAATTAATAGAAATGCTTTTAGTTGTACCCGTTTCTAAATCTTCAGCTATGCAG
AGGGCTGGTAGAGCAGGTAGATAATCTGCAGGTAAATGCTTTAGGCTCTACACCAAATAT
ACTCATGACACCTTGGCTGAATTTATGTTACCTGTATATAAAATATTACTTACATACTAA
ACGAATGAAATCATATATTTTACTATGTATATAAATAAAAGGAAATTCTCAGATCAAATC
TTTCAACAGTTATTTTGCAAATGAAAGCTATTGGAATTAAAGATGTTAAAGGATTCTAGT
TTATAGATAGACCACATGAAGACTAATTCATAGAAAGTATTGAAAACCTTTAACAGATGA
ACGCTTTAGATGCTAATGTAAGAAAGTAAAAAAAGAAATTTAATTAATTTATTGCTTTTT
TAAAAACAGGAAAATATTACTTTGCATGGTAAGGAAATGGCTGAATTACCTCTTGAACCA
ATATATGCTCATTTTATGCTTGTAGCTTTTGCTACTAATCCTAACTCGATTAGTGTTGTT
CTTTCAGCAATCAGTTTGATGCAAGTAGAAAATCTCTTTTTCATTCCTAAGGGTGCAAAA
ATATCTTTATTAGATGTTTTACTTAGGTTTTAGTTAGGAAATAGTGATTAATTGACAAAG
GTCAACATGCTGCACTAATATTATCTAGCAAAAAATAAAAAGAGTTTTTGTAAAGAAAAT
TTCATTAATCAAAAAAATATAAAGAAAGCTTTGGAAGTAAGATAATAATTAGAAAATTAC
TTCCTTGATATTCTTAAGAAGAGATCTAAAAAGAATTAAAAGTAAAACTAAGCAAATATC
TAATAGCAAAGTGAAGAGTAGTAAATTTAAGAAGAATTAGCAAAAGGAAATACATTAAAA
AAATTGTAAGAAGAACATAAAACAGCTATTTAATAGGAAATAAATACAGAAGAGTTTATA
TCATGTATTGCTAAAGGATTATCTGTGAAAGCTGCCAAGCTAAATAACGATGGAACTTAT
ACTATTATTGTAATTAAATTTATTATCTAACTTTTATTTATCTAATTTTTATAAATAATT
CAGAGAAGCAATATTCAAGCTTACATTCACCCTGAGAGTTTGCTGTTTTACTCAAAGCCT
AAACCTGATTATATCATTTTCAATGAAGTTGTTAGTACTATAAAAACGTATCTTAGAGAC
ATTACTGAAATATCATTCTCTGATTTTAAAGAAATTTCTAAATGA