Identifiers and Description

Gene Model Identifier

TTHERM_00441760

Standard Name

DRH21 (DExD/H box RNA helicase 21)

Aliases

PreTt05578 | 50.m00147 | 3681.m00006

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF01480 ) PWI domain
  • ( PF03128 ) CXCXC repeat
  • ( PF01457 ) Leishmanolysin
  • ( PF00008 ) EGF-like domain
  • ( PF07974 ) EGF-like domain
  • ( PF08825 ) E2 binding domain
  • ( TIGR01612 ) rhoptry protein
  • ( TIGR01360 ) adenylate kinase
  • ( PF00451 ) Scorpion short toxin
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF08758 ) Cadherin prodomain like
  • ( PF07986 ) Tubulin binding cofactor C
  • ( TIGR01967 ) ATP-dependent helicase HrpA
  • ( TIGR01970 ) ATP-dependent helicase HrpB
  • ( PF00020 ) TNFR/NGFR cysteine-rich region
  • ( PF02420 ) Insect antifreeze protein repeat
  • ( PF04408 ) Helicase associated domain (HA2)
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF03860 ) Domain of Unknown Function (DUF326)
  • ( PF05501 ) Domain of unknown function (DUF755)
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF07717 ) Domain of unknown function (DUF1605)
  • ( TIGR00179 ) UDP-N-acetylenolpyruvoylglucosamine reductase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00441760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_231710
WormBaseWBGene000033929.997093137033517e-262locus:mog-4 Probable pre-mRN
A-splicing factor ATP-dependen
t RNA helicase mog-4 status:
Confirmed UniProt:O45244 p
rotein_id:CAB03845.1
Tetrahymena borealisEI9_12515.19.997093137033517e-262RNA helicase (1067 aa)
DictyBaseDDB_G02859379.997093137033517e-262dhx16 on chromosome: 4 positio
n 3866187 to 3869507
OxytrichaContig3639.0.g119.997093137033517e-262Oligonucleotide/oligosaccharid
e-binding (OB)-fold
SGDYER013W9.997093137033517e-262PRP22 DEAH-box RNA-dependent A
TPase/ATP-dependent RNA helica
se, associates with lariat int
ermediates before the second c
atalytic step of splicing; med
iates ATP-dependent mRNA relea
se from the spliceosome and un
winds RNA duplexes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00441760(coding)
ATGCAGTATAATATTGAAGATTTCATTAATGATAGCTTACATAAAATATTAGGGATTTCT
GATAGGAATATAGTCATGTATATAAAAGGAGTGACACAGTCAAGCAAATCAAAAGATTAG
CTTATTGATGGTCTCAAAGAGATGGAAATCTATCCTACAGATTCAAAGTCAAAAGTATTT
ATTGATGAATTGTATATGAAATATGTTTAGGGAACAAGTGAAACGACTTCTTAAAGAAGT
AGCTACGTTTAAGAAGAAATAAGGAAGGCAGCTTAAGTTCAAAAAAATAGTAATTATTAA
ATTATAGAGGAAGATCCACTCTCAATTACAGATAATGCATAAAAAAAAATAAAAACAAAT
GATGGAAACCCAGCTGCTAATAATTTAACTGATAAAGAGAAAGCTGAGCTAGCAAAAAAA
AAAGATATAGAAGAGCGCAATGAAATAGATAAGAAAATAAAAGAAAAGGATATGAAAAAA
AAGTAAGCTTTGAGTGGAGGAGCTTAGCTAGGAATGAATTTGACTGCTGAAGAAAAAGCT
GAGCTCATTCCACTTTTACAAAAAGAAGCTAGATAAAACTATGTCAAAGGCAGATTAGAT
AAATAAGTTGAATTATTAAAGAGAATGATTGAATATGATGAATTTCTAATTAAAAATCAT
AAAGTTACAGACGAAGAAATCAAGAGTTATGAAGAAAAAAAGAAAATTTTAGAAGCTGTA
TAAAGTACAGACTTAACATAAAAAGAAGCAGATATATATGAAATGCCTTAGCTTTTTGAA
GATGATGAAGGAAAATATGATAGGAGAAAAGCTGCTAATGCTCAAACTTAAAAATATAAA
GATGTTCCTTATGAACCTAGTGAGCATGAAAAATGGGAGAGGGAATAGACTTAACGAAAC
TAAGTAAAATTTGGAACTAACACTTTAACAAAGCAGTAATAAGAAGAACAAAACTATAAA
ATATTAATGGAAAATGAAATTTAATTTATCAAGAGTGATATAATTAAAGAGCAATTGCTT
AAATAAAAACAAATGCTTGATAGTATGAAGAGTAAAAAAAAATCTAAAAAGAGTTCTAAG
AAAGACAAGAAAAAATCTAAGAAGAAAAGCAAAGATTCTTCAGATTCATCTGAAGACTCA
GAAGGGTCATCTAGTGGTGATGAGACACAGGACGATAATATTTACATCAAGAATGATTAA
TAACCTTAAAACTAATAAGAGTTACTTTAATTAAGTGAAAGGGAGAAAATGAAGAGAGTT
CGCCAATCACTACCTATTTATAAATATAGAGAAGAACTTCTTACTTTGATAAGAGATAAT
AGAGTTATTGTCATGGTTGGTGAGACTGGTTCAGGTAAAACGACACAAGTACCTTAGTAT
TTGCACGAAGTTGGATACACAAGCACAGGTAGAATAGGTTGTACTCAGCCTAGAAGAGTA
GCAGCTATGAGTGTAGCAGCTCGTGTTTCAGAAGAAATGGGAACAAAATTAGGTCATGAA
GTTGGTTACTCTATTCGTTTTGAAGACTGTACAAGCGATAAAACTGTTATTAAATATATG
ACAGATGGTATGCTACTTCGTGAACTGATGATGGAGCCTGATTTGGCATCTTACTCTGTT
ATGATTGTTGATGAAGCACATGAACGTACTCTTCACACAGATATTTTGTTGTCTATTATT
AAAGATCTTTCTCGTGCTAGAGATGATTTAAAAGTTATTATTTCATCAGCTACTATTGAT
GCTTAAAGATTTTCTGAATATTTTGATAACTGTCCAATTATTAAAATTCCAGGAAGGCGT
TTTTAGGTTGATATTTACTATACCAAGGCACCCGAATCTGATTATATTTAAGCTGCTGTT
CTGACTGTTCTTTAAATTCATGTCACACAGCCGAAAGGAGATATATTGGTTTTTCTAACT
GGTTAAGAAGAAATAGAAGCTGCAGAAGAGATGCTAACTGCAAGAACTCGTGGTCTAGGA
AATAAGATAGGAGAGCTTTTAATATGCCCTATTTACTCTTCTTTACCTTCTGATATGCAA
GCAAAAATTTTTGAACCTACTCCTGCTGGAGCAAGAAAAGTTGTACTTTCAACAAATATA
GCAGAAACATCTATCACTATTGATAATATTATATACGTTATAGATACTGGATTTGCTAAA
TAAACTTCTTATAACCCCCGTACAGGAATGGAGAGTTTGATAGTCACTCCTATTTCCAAA
GCATCTGCAGATTAAAGAGCAGGACGTGCTGGTAGAGTAGCACCAGGTAAATGCTTTCGT
ATGTATACCAAGTGGAGTTTCTTAAATGAACTTGATTAAAATACAATACCAGAAATTTAA
CGTACTAATCTTGGTTCTGTTGTGTTAATGTTAAAAAGTATGGGTATAAATAATTTAGTT
AATTTCGATTTTATGGACTCTCCTCCTCCTGAAATGATTGTCAAATCTCTTGAATAATTA
TATGCATTGGGAGCAATAAATGATGAGGGTGATCTTACAAAGCTGGGCAGGAGAATGGCT
GAGTTTCCTTTAGATCCTTTCTTGAGTAAAATGTTAGTTTAATCTGAGCATTATAAATGT
GTGGATCAGATTATTACTATTTGTGCTATGCTTTCAGTAGGAAATACCATATTTTACAGA
CCAAATGATAAAGAGAAAAAAATACATGCAGACAATTCGAGAAAAGCATTCTTCCGTCCA
GGTGGTGACCATCTAGCCCTCCTAAATGTTTACAACACATGGGCTGATAATGGATTTTCA
TAAAATTGGTGCTTTGAAAATTTTATTTAAATAAGATCAATGAGACGTGCAAGAGATGTT
AGAGAATAATTAATATTATTATGTGAGCGTGTTGAAATAGATGTTAAAGACCCAAGTTTA
AGTATATTTGAAGATGAAATGAATACAAATATTTGCAAATGTATTTGTAGTGGGTTCTTT
TATAATGCAGCTAAAACAAATTTAAACGGAACATACAAGACGTTAAAAAATGGGCATTCA
ATAACCATCCACCCAAGCTCCTTGATGTTTGATATCAAGCCTGAATGGATTGTTTACAAT
GAATTAGTTTTCACTTCAAAAGAATATGTTCGTAATGTAATTGAAGTAAAAGGAGAATGG
TTAATTGAAATAGCTCCTCACCTTTATAAAGAAAAAGATTTACTTGGTGATAAACGTAAA
ATGCCTAAAAACACAGGCACTTCTGATAGTAGAAATTGA


>TTHERM_00441760(protein)
MQYNIEDFINDSLHKILGISDRNIVMYIKGVTQSSKSKDQLIDGLKEMEIYPTDSKSKVF
IDELYMKYVQGTSETTSQRSSYVQEEIRKAAQVQKNSNYQIIEEDPLSITDNAQKKIKTN
DGNPAANNLTDKEKAELAKKKDIEERNEIDKKIKEKDMKKKQALSGGAQLGMNLTAEEKA
ELIPLLQKEARQNYVKGRLDKQVELLKRMIEYDEFLIKNHKVTDEEIKSYEEKKKILEAV
QSTDLTQKEADIYEMPQLFEDDEGKYDRRKAANAQTQKYKDVPYEPSEHEKWEREQTQRN
QVKFGTNTLTKQQQEEQNYKILMENEIQFIKSDIIKEQLLKQKQMLDSMKSKKKSKKSSK
KDKKKSKKKSKDSSDSSEDSEGSSSGDETQDDNIYIKNDQQPQNQQELLQLSEREKMKRV
RQSLPIYKYREELLTLIRDNRVIVMVGETGSGKTTQVPQYLHEVGYTSTGRIGCTQPRRV
AAMSVAARVSEEMGTKLGHEVGYSIRFEDCTSDKTVIKYMTDGMLLRELMMEPDLASYSV
MIVDEAHERTLHTDILLSIIKDLSRARDDLKVIISSATIDAQRFSEYFDNCPIIKIPGRR
FQVDIYYTKAPESDYIQAAVLTVLQIHVTQPKGDILVFLTGQEEIEAAEEMLTARTRGLG
NKIGELLICPIYSSLPSDMQAKIFEPTPAGARKVVLSTNIAETSITIDNIIYVIDTGFAK
QTSYNPRTGMESLIVTPISKASADQRAGRAGRVAPGKCFRMYTKWSFLNELDQNTIPEIQ
RTNLGSVVLMLKSMGINNLVNFDFMDSPPPEMIVKSLEQLYALGAINDEGDLTKLGRRMA
EFPLDPFLSKMLVQSEHYKCVDQIITICAMLSVGNTIFYRPNDKEKKIHADNSRKAFFRP
GGDHLALLNVYNTWADNGFSQNWCFENFIQIRSMRRARDVREQLILLCERVEIDVKDPSL
SIFEDEMNTNICKCICSGFFYNAAKTNLNGTYKTLKNGHSITIHPSSLMFDIKPEWIVYN
ELVFTSKEYVRNVIEVKGEWLIEIAPHLYKEKDLLGDKRKMPKNTGTSDSRN


>TTHERM_00441760(gene)
ATGCAGTATAATATTGAAGATTTCATTAATGATAGCTTACATAAAATATTAGGGATTTCT
GATAGGAATATAGTCATGTATATAAAAGGAGTGACACAGTCAAGCAAATCAAAAGATTAG
CTTATTGATGGTCTCAAAGAGATGGAAATCTATCCTACAGATTCAAAGTCAAAAGTATTT
ATTGATGAATTGTATATGAAATATGTTTAGGGAACAAGTGAAACGACTTCTTAAAGAAGT
AGCTACGTTTAAGAAGAAATAAGGAAGGCAGCTTAAGTTCAAAAAAATAGTAATTATTAA
ATTATAGAGGAAGATCCACTCTCAATTACAGATAATGCATAAAAAAAAATAAAAACAAAT
GATGGAAACCCAGCTGCTAATAATTTAACTGATAAAGAGAAAGCTGAGCTAGCAAAAAAA
AAAGATATAGAAGAGCGCAATGAAATAGATAAGAAAATAAAAGAAAAGGATATGAAAAAA
AAGTAAGCTTTGAGTGGAGGAGCTTAGCTAGGAATGAATTTGACTGCTGAAGAAAAAGCT
GAGCTCATTCCACTTTTACAAAAAGAAGCTAGATAAAACTATGTCAAAGGCAGATTAGAT
AAATAAGTTGAATTATTAAAGAGAATGATTGAATATGATGAATTTCTAATTAAAAATCAT
AAAGTTACAGACGAAGAAATCAAGAGTTATGAAGAAAAAAAGAAAATTTTAGAAGCTGTA
TAAAGTACAGACTTAACATAAAAAGAAGCAGATATATATGAAATGCCTTAGCTTTTTGAA
GATGATGAAGGAAAATATGATAGGAGAAAAGCTGCTAATGCTCAAACTTAAAAATATAAA
GATGTTCCTTATGAACCTAGTGAGCATGAAAAATGGGAGAGGGAATAGACTTAACGAAAC
TAAGTAAAATTTGGAACTAACACTTTAACAAAGCAGTAATAAGAAGAACAAAACTATAAA
ATATTAATGGAAAATGAAATTTAATTTATCAAGAGTGATATAATTAAAGAGCAATTGCTT
AAATAAAAACAAATGCTTGATAGTATGAAGAGTAAAAAAAAATCTAAAAAGAGTTCTAAG
AAAGACAAGAAAAAATCTAAGAAGAAAAGCAAAGATTCTTCAGATTCATCTGAAGACTCA
GAAGGGTCATCTAGTGGTGATGAGACACAGGACGATAATATTTACATCAAGAATGATTAA
TAACCTTAAAACTAATAAGAGTTACTTTAATTAAGTGAAAGGGAGAAAATGAAGAGAGTT
CGCCAATCACTACCTATTTATAAATATAGAGAAGAACTTCTTACTTTGATAAGAGATAAT
AGAGTTATTGTCATGGTTGGTGAGACTGGTTCAGGTAAAACGACACAAGTACCTTAGTAT
TTGCACGAAGTTGGATACACAAGCACAGGTAGAATAGGTTGTACTCAGCCTAGAAGAGTA
GCAGCTATGAGTGTAGCAGCTCGTGTTTCAGAAGAAATGGGAACAAAATTAGGTCATGAA
GTTGGTTACTCTATTCGTTTTGAAGACTGTACAAGCGATAAAACTGTTATTAAATATATG
ACAGATGGTATGCTACTTCGTGAACTGATGATGGAGCCTGATTTGGCATCTTACTCTGTT
ATGATTGTTGATGAAGCACATGAACGTACTCTTCACACAGATATTTTGTTGTCTATTATT
AAAGATCTTTCTCGTGCTAGAGATGATTTAAAAGTTATTATTTCATCAGCTACTATTGAT
GCTTAAAGATTTTCTGAATATTTTGATAACTGTCCAATTATTAAAATTCCAGGAAGGCGT
TTTTAGGTTGATATTTACTATACCAAGGCACCCGAATCTGATTATATTTAAGCTGCTGTT
CTGACTGTTCTTTAAATTCATGTCACACAGCCGAAAGGAGATATATTGGTTTTTCTAACT
GGTTAAGAAGAAATAGAAGCTGCAGAAGAGATGCTAACTGCAAGAACTCGTGGTCTAGGA
AATAAGATAGGAGAGCTTTTAATATGCCCTATTTACTCTTCTTTACCTTCTGATATGCAA
GCAAAAATTTTTGAACCTACTCCTGCTGGAGCAAGAAAAGTTGTACTTTCAACAAATATA
GCAGAAACATCTATCACTATTGATAATATTATATACGTTATAGATACTGGATTTGCTAAA
TAAACTTCTTATAACCCCCGTACAGGAATGGAGAGTTTGATAGTCACTCCTATTTCCAAA
GCATCTGCAGATTAAAGAGCAGGACGTGCTGGTAGAGTAGCACCAGGTAAATGCTTTCGT
ATGTATACCAAGTGGAGTTTCTTAAATGAACTTGATTAAAATACAATACCAGAAATTTAA
CGTACTAATCTTGGTTCTGTTGTGTTAATGTTAAAAAGTATGGGTATAAATAATTTAGTT
AATTTCGATTTTATGGACTCTCCTCCTCCTGAAATGATTGTCAAATCTCTTGAATAATTA
TATGCATTGGGAGCAATAAATGATGAGGGTGATCTTACAAAGCTGGGCAGGAGAATGGCT
GAGTTTCCTTTAGATCCTTTCTTGAGTAAAATGTTAGTTTAATCTGAGCATTATAAATGT
GTGGATCAGATTATTACTATTTGTGCTATGCTTTCAGTAGGAAATACCATATTTTACAGA
CCAAATGATAAAGAGAAAAAAATACATGCAGACAATTCGAGAAAAGCATTCTTCCGTCCA
GGTGGTGACCATCTAGCCCTCCTAAATGTTTACAACACATGGGCTGATAATGGATTTTCA
TAAAATTGGTGCTTTGAAAATTTTATTTAAATAAGATCAATGAGACGTGCAAGAGATGTT
AGAGAATAATTAATATTATTATGTGAGCGTGTTGAAATAGATGTTAAAGACCCAAGTTTA
AGTATATTTGAAGATGAAATGAATACAAATATTTGCAAATGTATTTGTAGTGGGTTCTTT
TATAATGCAGCTAAAACAAATTTAAACGGAACATACAAGACGTTAAAAAATGGGCATTCA
ATAACCATCCACCCAAGCTCCTTGATGTTTGATATCAAGCCTGAATGGATTGTTTACAAT
GAATTAGTTTTCACTTCAAAAGAATATGTTCGTAATGTAATTGAAGTAAAAGGAGAATGG
TTAATTGAAATAGCTCCTCACCTTTATAAAGAAAAAGATTTACTTGGTGATAAACGTAAA
ATGCCTAAAAACACAGGCACTTCTGATAGTAGAAATTGA