Identifiers and Description

Gene Model Identifier

TTHERM_00444310

Standard Name

DRH20 (DExD/H box RNA helicase 20)

Aliases

PreTt03799 | 51.m00165 | 3704.m00020

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00575 ) S1 RNA binding domain
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01967 ) ATP-dependent helicase HrpA
  • ( TIGR01970 ) ATP-dependent helicase HrpB
  • ( PF04408 ) Helicase associated domain (HA2)
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( PF04642 ) Protein of unknown function, DUF601
  • ( PF00005 ) ABC transporter, ATP-binding protein
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF07717 ) Domain of unknown function (DUF1605)
  • ( PF08648 ) Protein of unknown function (DUF1777)
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00444310

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_184220
WormBaseWBGene000033939.997093137033517e-262locus:mog-5 Probable pre-mRN
A-splicing factor ATP-dependen
t RNA helicase mog-5 status:
Confirmed UniProt:Q09530 p
rotein_id:CCD68732.1
Tetrahymena borealisEI9_10926.19.997093137033517e-262ATP-dependent helicase DHX8, R
NA helicase HRH1 (1308 aa)
DictyBaseDDB_G02911839.997093137033517e-262dhx8 on chromosome: 5 position
5107365 to 5110847
OxytrichaContig13549.0.g409.997093137033517e-262Oligonucleotide/oligosaccharid
e-binding (OB)-fold
SGDYER013W9.997093137033517e-262PRP22 DEAH-box RNA-dependent A
TPase/ATP-dependent RNA helica
se, associates with lariat int
ermediates before the second c
atalytic step of splicing; med
iates ATP-dependent mRNA relea
se from the spliceosome and un
winds RNA duplexes

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444310(coding)
ATGGCTTCTAATTTATAGTATGTCCTTCTCAGCTAGCAGGTTATGCAACAGCTGAAAACA
CAACTAGGAATTTAGGATAAAGATTTAGTAGATTATTTTATAGATTAAGCATTTGAATCA
GATACTGAGCAATAGTTTGCTGAAAATATTAAAGATGATGCAGAATTATCAGACTAATTT
ATTTCTAGTTTATATAAATTGATTAAGTCAAAGTAGAGCTTAATTAAACCGAAAGTTGAT
CTTCAAGCATAAAATAAATAACTTGAGGACAAGAAAAATAAATTTTCTGCAGGAGATCCA
TAAAAAATTGATATTGAAATCGAAAAAGAGGATATCAAGCAAAAAGAAAAGGTTAAAAGA
GATGAAAATTATGAAAATGAAGATAGTGATGAAGAATAGAATGAATTAAAAAGACAAGAA
CTAGAAAAGAGAAAGCAATATGCTAAAATTTTCCCAGCTCTTGCATAGAGAGATGAAATA
GATCTGGATTAACCTTAACCAGAGTAAAAAGTGGACAAAAATAGTAGTAAATTCGATCCA
AAGCCGACTAATATTGATGCAAGATAAGAAAAAGAAAAAGAGACTTCAAATAAAGAAATC
AGTAGAAAAAAAAGTAGCAAGCATTCAAGAAGCAGAAGCAAGTCTCATAAAAAGGAAAAA
AGTAAAAGAAGGTCTAGAAGTCGCTCATAAGGTAAAAGTAAGAAGAAATACTCTAGAAGT
AGGTCAAAAGAAAAAAAAAATCGCTCTTATTCAAAAGAAAAGAAAAGTCGTCGTTCACGC
TCTAAATCTCATGAAAAAAAGAAAAAAAGGGATTCCCCTGATGCAAAAAAAGATCATAGA
AAAAAATATTAGAGAGATTCGAATTCACCACTCAGAGAGAAAAAGGGTAGAGAAAATAGT
TCTCGCAGCAGATCATAAGAAAAGCAAACTCGTTAGCAATTCAAGAGATAAGAAGTTGAA
AAGGACTCAATTTTAGATGGAGTTGTTTCTAAAATAAGTGAATTTGGTTGTTTTGTAACA
TTAGAAAATGTTGGAGGGCGTAAAGAAGGTTTGGTTCACATTAGCTAGCTTTCAAGCAAA
AGAGTTGGAAATATTTAAGAAGTAGCGAGAATTGGATAAAGAGTAAAAGTAAAAGTAATA
AGTGTGATAGGAAACAAAATTAGTTTGAGTATGAAAGATGTTGATTAAATAACTGGTTTA
GATAAGTTTGAACAAAAAATACGATATGAGGAATCCTAATCTCTCAAGTATGACCCTCTT
GAGTAGAAAGAAAAGAAGGCATTTGGTGTGTTAGATAAAGATGATATTATCAAATCAAAT
TAAAATTCAAAGTTCGGTGCTCTAACAGGTATTCTACTTGAAGATAAAGAGGAAAAAAAT
AAAAAGAGAATCAGAGAAAGTTCTTAAGAAAAGTGGGAACGTAAGTAAGCAGAATACTAT
TCCAGTAAACATTTGGGTATTGATAAAGGCGAAATAGATTTAGATGAAGGTTGTTCAGAA
GATGAAGATGTTGAAGTTGAAATTCGTGAGAACGAAACTCCCTTCTTAAAAGATACGACA
ACAAAGGCAGGAGTAAACTTATCTCCTATTAGAGTTACTAAAAACTAGAATGGCTCTTTG
AGTAGACAAGCACTTAATGCAGTTTAACAAGCAAAAGATAGAAGAGAAATTCGTATTTAG
CAAAACAATGCTTTGGTAGATAGTATTAACAAATAAGAACTCTAAAAAATGAATTTAGAT
CCTACTGCAGAATCTATTTTCCTTTTAAGTAATTTAAAGAAGTTGGGAGATGCTTAAACA
TCGGAAATTCCAGAATTTAAAAAAGAAGCAATGTTTAAGGCTGCTCTCAACAACTCTAAC
AAACCAAAATAAACTATGACAATCAAGGAGTAAAAAGAATCTCTTCCTATCTATTAATAT
AAGGAATAACTTATCAAAGCTTGCATTAATAATTAAATTCTTATTGTTATTGGTGAAACC
GGTTCAGGAAAAACAACTTAAATGACATAGTATCTCTTAGAAGCAGGCTTTTGTAAGAGT
GGTAAGAAAATTGGGTGTACCTAACCTCGTCGTGTTGCAGCTATGAGTGTTGCTAAGCGT
GTTTCTGAAGAAATGGGTGTAGTACTTGGTGAAGAAGTAGGTTATTCAATACGTTTTGAA
GATTGTACATCTGCTTCTACAGTAATTAAATATATGACTGATGGTATGCTTCTTCGTGAG
GCCTTGCTTGACACAGAACTAAGCAACTACTCAGTTATTATGCTCGATGAAGCACATGAA
AGATAGCTAAATACAGATGTTCTTTTTGGTTTACTTAAGAAAGTAGCTAAGAAAAGAAAA
GATTTTCATTTGATTATTACTTCCGCTACCCTTGATGCTGCAAAATTCTCTAATTATTTC
TTTGATTGCTAAGTTTTCCGTGTACCAGGTCGTACCTTCAAAGTCGATGTCCTCTACTCT
GTAGAACCTGAATAGGATTATGTTGAAGCTTCTTTAATTGTAATCATGCAAATTCACTTG
CATGAACCTCCTGGCGATATTCTCCTTTTCTTAACAGGTCAAGAAGAAATTGATAATGCA
TGCTAAATATTATTCTAGCGTATGAAGAACTTAGGTCCAGATGCACCTGAACTTATTATA
TTACCTCTTTATGCTGGTTTGCCTAATGAACTATAGAATAGAATTTTCCTTCCTACTCCT
GAGGGAAAACGTAAATGTATTATATCAACTAATATTGCAGAAGCATCTCTTACCATCGAT
GGTATTTACTATGTCGTAGATCCAGGATTTGCAAAAATTAAAGTTTACAATCCAAAACTT
GGTATGGATTCCTTGATTGTTGCACCAATTTCATAGGCTTCAGCGAAATAACGTTAGGGT
CGTGCAGGTCGTACAGGTCCTGGTAAATGTTTCCGTCTTTATACTGAAGATGCTTTCAAA
AATGAAATGCTCCCAACAAGTATACCTGAAATTCAGCGTACAAACTTAGCAAACACGGTT
TTACTTTTAAAGGCAATGGGTATTAATGATTTAATCAACTTCGATTTTATGGATCCTCCT
CCTATTCAAACTTTGATTTCTGCTTTAGAACATCTTTACACTTTAGGTTGTTTGGATGAT
GAAGGTCTCCTTACACGTCTCGGTTTGAAAATGGCCGAATTTCCTTTAGAACCACCTCTC
TCTAAAATGCTTATAACAAGTGTTGATCTTGGATGTTCAGATGAAATAGCTACTATTATT
GCTATGTTGTCAGTTTAAAATGTATTTTTCTGTCCAAAAGATAAAAAATAACAAGCTGAC
CAGCGTCGTGCTAAATTTCATCATTAAGATGGAGACCACTTAACTCTTTTGACTGTATAC
GAAGCTTGGAAATCAAACAATTTTTCAAATATTTGGTGTCATGAGAATTTCATAGATTCT
AGAACAATAAAAAGAGCACAAGATATTCGTAAACAGTTGATAGGTATCATGGACCGCTAT
CATTTACCTGTTTAATCGTGTGGTAAAAATTATGCCAAAATCCGTAAGGCTATATGTGCA
GGCTTCTTTAATCATGCAGCAAAAAAAGATCGTAACGAAGGATACAAAACTATCATAGAT
AATCATACTGTTAACATACATCCTACATCTGCACTTTTTTAGAAGCAGCCGGATTGGGTA
GTTTATCACGAATTAGTTTTGACAACTAAAGAATATATGAGAAATATTTCCACAATAGAA
CCAAAGTGGCTTGTTGAAGTTGCACCGAATTTCTTTTAAAACGTAAACCCTCATGTATTA
TCAAAAGCTAAAAAGGCTGAAAAGCTTGAATCACTCTCAACTAAAAGTGGTGATAACGAA
GCTTGGCGTCTGTCTAAAAGAAGAGGAAATGGTTGA


>TTHERM_00444310(protein)
MASNLQYVLLSQQVMQQLKTQLGIQDKDLVDYFIDQAFESDTEQQFAENIKDDAELSDQF
ISSLYKLIKSKQSLIKPKVDLQAQNKQLEDKKNKFSAGDPQKIDIEIEKEDIKQKEKVKR
DENYENEDSDEEQNELKRQELEKRKQYAKIFPALAQRDEIDLDQPQPEQKVDKNSSKFDP
KPTNIDARQEKEKETSNKEISRKKSSKHSRSRSKSHKKEKSKRRSRSRSQGKSKKKYSRS
RSKEKKNRSYSKEKKSRRSRSKSHEKKKKRDSPDAKKDHRKKYQRDSNSPLREKKGRENS
SRSRSQEKQTRQQFKRQEVEKDSILDGVVSKISEFGCFVTLENVGGRKEGLVHISQLSSK
RVGNIQEVARIGQRVKVKVISVIGNKISLSMKDVDQITGLDKFEQKIRYEESQSLKYDPL
EQKEKKAFGVLDKDDIIKSNQNSKFGALTGILLEDKEEKNKKRIRESSQEKWERKQAEYY
SSKHLGIDKGEIDLDEGCSEDEDVEVEIRENETPFLKDTTTKAGVNLSPIRVTKNQNGSL
SRQALNAVQQAKDRREIRIQQNNALVDSINKQELQKMNLDPTAESIFLLSNLKKLGDAQT
SEIPEFKKEAMFKAALNNSNKPKQTMTIKEQKESLPIYQYKEQLIKACINNQILIVIGET
GSGKTTQMTQYLLEAGFCKSGKKIGCTQPRRVAAMSVAKRVSEEMGVVLGEEVGYSIRFE
DCTSASTVIKYMTDGMLLREALLDTELSNYSVIMLDEAHERQLNTDVLFGLLKKVAKKRK
DFHLIITSATLDAAKFSNYFFDCQVFRVPGRTFKVDVLYSVEPEQDYVEASLIVIMQIHL
HEPPGDILLFLTGQEEIDNACQILFQRMKNLGPDAPELIILPLYAGLPNELQNRIFLPTP
EGKRKCIISTNIAEASLTIDGIYYVVDPGFAKIKVYNPKLGMDSLIVAPISQASAKQRQG
RAGRTGPGKCFRLYTEDAFKNEMLPTSIPEIQRTNLANTVLLLKAMGINDLINFDFMDPP
PIQTLISALEHLYTLGCLDDEGLLTRLGLKMAEFPLEPPLSKMLITSVDLGCSDEIATII
AMLSVQNVFFCPKDKKQQADQRRAKFHHQDGDHLTLLTVYEAWKSNNFSNIWCHENFIDS
RTIKRAQDIRKQLIGIMDRYHLPVQSCGKNYAKIRKAICAGFFNHAAKKDRNEGYKTIID
NHTVNIHPTSALFQKQPDWVVYHELVLTTKEYMRNISTIEPKWLVEVAPNFFQNVNPHVL
SKAKKAEKLESLSTKSGDNEAWRLSKRRGNG


>TTHERM_00444310(gene)
ATGGCTTCTAATTTATAGTATGTCCTTCTCAGCTAGCAGGTTATGCAACAGCTGAAAACA
CAACTAGGAATTTAGGATAAAGATTTAGTAGATTATTTTATAGATTAAGCATTTGAATCA
GATACTGAGCAATAGTTTGCTGAAAATATTAAAGATGATGCAGAATTATCAGACTAATTT
ATTTCTAGTTTATATAAATTGATTAAGTCAAAGTAGAGCTTAATTAAACCGAAAGTTGAT
CTTCAAGCATAAAATAAATAACTTGAGGACAAGAAAAATAAATTTTCTGCAGGAGATCCA
TAAAAAATTGATATTGAAATCGAAAAAGAGGATATCAAGCAAAAAGAAAAGGTTAAAAGA
GATGAAAATTATGAAAATGAAGATAGTGATGAAGAATAGAATGAATTAAAAAGACAAGAA
CTAGAAAAGAGAAAGCAATATGCTAAAATTTTCCCAGCTCTTGCATAGAGAGATGAAATA
GATCTGGATTAACCTTAACCAGAGTAAAAAGTGGACAAAAATAGTAGTAAATTCGATCCA
AAGCCGACTAATATTGATGCAAGATAAGAAAAAGAAAAAGAGACTTCAAATAAAGAAATC
AGTAGAAAAAAAAGTAGCAAGCATTCAAGAAGCAGAAGCAAGTCTCATAAAAAGGAAAAA
AGTAAAAGAAGGTCTAGAAGTCGCTCATAAGGTAAAAGTAAGAAGAAATACTCTAGAAGT
AGGTCAAAAGAAAAAAAAAATCGCTCTTATTCAAAAGAAAAGAAAAGTCGTCGTTCACGC
TCTAAATCTCATGAAAAAAAGAAAAAAAGGGATTCCCCTGATGCAAAAAAAGATCATAGA
AAAAAATATTAGAGAGATTCGAATTCACCACTCAGAGAGAAAAAGGGTAGAGAAAATAGT
TCTCGCAGCAGATCATAAGAAAAGCAAACTCGTTAGCAATTCAAGAGATAAGAAGTTGAA
AAGGACTCAATTTTAGATGGAGTTGTTTCTAAAATAAGTGAATTTGGTTGTTTTGTAACA
TTAGAAAATGTTGGAGGGCGTAAAGAAGGTTTGGTTCACATTAGCTAGCTTTCAAGCAAA
AGAGTTGGAAATATTTAAGAAGTAGCGAGAATTGGATAAAGAGTAAAAGTAAAAGTAATA
AGTGTGATAGGAAACAAAATTAGTTTGAGTATGAAAGATGTTGATTAAATAACTGGTTTA
GATAAGTTTGAACAAAAAATACGATATGAGGAATCCTAATCTCTCAAGTATGACCCTCTT
GAGTAGAAAGAAAAGAAGGCATTTGGTGTGTTAGATAAAGATGATATTATCAAATCAAAT
TAAAATTCAAAGTTCGGTGCTCTAACAGGTATTCTACTTGAAGATAAAGAGGAAAAAAAT
AAAAAGAGAATCAGAGAAAGTTCTTAAGAAAAGTGGGAACGTAAGTAAGCAGAATACTAT
TCCAGTAAACATTTGGGTATTGATAAAGGCGAAATAGATTTAGATGAAGGTTGTTCAGAA
GATGAAGATGTTGAAGTTGAAATTCGTGAGAACGAAACTCCCTTCTTAAAAGATACGACA
ACAAAGGCAGGAGTAAACTTATCTCCTATTAGAGTTACTAAAAACTAGAATGGCTCTTTG
AGTAGACAAGCACTTAATGCAGTTTAACAAGCAAAAGATAGAAGAGAAATTCGTATTTAG
CAAAACAATGCTTTGGTAGATAGTATTAACAAATAAGAACTCTAAAAAATGAATTTAGAT
CCTACTGCAGAATCTATTTTCCTTTTAAGTAATTTAAAGAAGTTGGGAGATGCTTAAACA
TCGGAAATTCCAGAATTTAAAAAAGAAGCAATGTTTAAGGCTGCTCTCAACAACTCTAAC
AAACCAAAATAAACTATGACAATCAAGGAGTAAAAAGAATCTCTTCCTATCTATTAATAT
AAGGAATAACTTATCAAAGCTTGCATTAATAATTAAATTCTTATTGTTATTGGTGAAACC
GGTTCAGGAAAAACAACTTAAATGACATAGTATCTCTTAGAAGCAGGCTTTTGTAAGAGT
GGTAAGAAAATTGGGTGTACCTAACCTCGTCGTGTTGCAGCTATGAGTGTTGCTAAGCGT
GTTTCTGAAGAAATGGGTGTAGTACTTGGTGAAGAAGTAGGTTATTCAATACGTTTTGAA
GATTGTACATCTGCTTCTACAGTAATTAAATATATGACTGATGGTATGCTTCTTCGTGAG
GCCTTGCTTGACACAGAACTAAGCAACTACTCAGTTATTATGCTCGATGAAGCACATGAA
AGATAGCTAAATACAGATGTTCTTTTTGGTTTACTTAAGAAAGTAGCTAAGAAAAGAAAA
GATTTTCATTTGATTATTACTTCCGCTACCCTTGATGCTGCAAAATTCTCTAATTATTTC
TTTGATTGCTAAGTTTTCCGTGTACCAGGTCGTACCTTCAAAGTCGATGTCCTCTACTCT
GTAGAACCTGAATAGGATTATGTTGAAGCTTCTTTAATTGTAATCATGCAAATTCACTTG
CATGAACCTCCTGGCGATATTCTCCTTTTCTTAACAGGTCAAGAAGAAATTGATAATGCA
TGCTAAATATTATTCTAGCGTATGAAGAACTTAGGTCCAGATGCACCTGAACTTATTATA
TTACCTCTTTATGCTGGTTTGCCTAATGAACTATAGAATAGAATTTTCCTTCCTACTCCT
GAGGGAAAACGTAAATGTATTATATCAACTAATATTGCAGAAGCATCTCTTACCATCGAT
GGTATTTACTATGTCGTAGATCCAGGATTTGCAAAAATTAAAGTTTACAATCCAAAACTT
GGTATGGATTCCTTGATTGTTGCACCAATTTCATAGGCTTCAGCGAAATAACGTTAGGGT
CGTGCAGGTCGTACAGGTCCTGGTAAATGTTTCCGTCTTTATACTGAAGATGCTTTCAAA
AATGAAATGCTCCCAACAAGTATACCTGAAATTCAGCGTACAAACTTAGCAAACACGGTT
TTACTTTTAAAGGCAATGGGTATTAATGATTTAATCAACTTCGATTTTATGGATCCTCCT
CCTATTCAAACTTTGATTTCTGCTTTAGAACATCTTTACACTTTAGGTTGTTTGGATGAT
GAAGGTCTCCTTACACGTCTCGGTTTGAAAATGGCCGAATTTCCTTTAGAACCACCTCTC
TCTAAAATGCTTATAACAAGTGTTGATCTTGGATGTTCAGATGAAATAGCTACTATTATT
GCTATGTTGTCAGTTTAAAATGTATTTTTCTGTCCAAAAGATAAAAAATAACAAGCTGAC
CAGCGTCGTGCTAAATTTCATCATTAAGATGGAGACCACTTAACTCTTTTGACTGTATAC
GAAGCTTGGAAATCAAACAATTTTTCAAATATTTGGTGTCATGAGAATTTCATAGATTCT
AGAACAATAAAAAGAGCACAAGATATTCGTAAACAGTTGATAGGTATCATGGACCGCTAT
CATTTACCTGTTTAATCGTGTGGTAAAAATTATGCCAAAATCCGTAAGGCTATATGTGCA
GGCTTCTTTAATCATGCAGCAAAAAAAGATCGTAACGAAGGATACAAAACTATCATAGAT
AATCATACTGTTAACATACATCCTACATCTGCACTTTTTTAGAAGCAGCCGGATTGGGTA
GTTTATCACGAATTAGTTTTGACAACTAAAGAATATATGAGAAATATTTCCACAATAGAA
CCAAAGTGGCTTGTTGAAGTTGCACCGAATTTCTTTTAAAACGTAAACCCTCATGTATTA
TCAAAAGCTAAAAAGGCTGAAAAGCTTGAATCACTCTCAACTAAAAGTGGTGATAACGAA
GCTTGGCGTCTGTCTAAAAGAAGAGGAAATGGTTGA