Identifiers and Description

Gene Model Identifier

TTHERM_00420420

Standard Name

DRH2 (DExD/H box RNA helicase 2)

Aliases

PreTt07167 | 46.m00222 | 3679.m00072

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF08243 ) SPT2 chromatin protein
  • ( TIGR00643 ) ATP-dependent DNA helicase RecG
  • ( TIGR01389 ) ATP-dependent DNA helicase RecQ
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF08648 ) Protein of unknown function (DUF1777)
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00420420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_307490
Tetrahymena borealisEI9_11031.19.997093137033517e-262DEAD/DEAH box helicase (1914 a
a)
OxytrichaContig18987.0.g899.997093137033517e-262DEAD/DEAH box helicase
DictyBaseDDB_G02754432.999784173812224e-165helB1 on chromosome: 2 positio
n 5780689 to 5784247
WormBaseWBGene000187769.99955252024689e-165status:Partially_confirmed U
niProt:U4PRR4 protein_id:CDH
93272.1
SGDYBR237W6.002136614931438e-113PRP5 RNA helicase in the DEAD-
box family, necessary for pres
pliceosome formation, bridges
U1 and U2 snRNPs and enables s
table U2 snRNP association wit
h intron RNA

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00420420(coding)
ATGATGATGAGTCTGAAGATGATGAAAATGATTAACCTATTTAATCAAATAAAAATTTTT
AAGCCTAAAGAAACAAATATTAATTCGCAAGTAATATAGCCAATTTAAGATTAATAAAAT
GATTCTCCCAGAATTTAATTAGAATAGGATCCAATTATGATTTAAATTTAGCAATAAATA
GAAGCTTAGGCTAAGAAATAAAGTAACTAAAGCTAAAACAAATAAAATTTAGAAAGCCCA
AGTTAACCTTCGATAGAAAATGAAGCAAATAGAGAGCTAGTTGAAAACTAAAATGAATTT
GAAGAGGAAATGATTTTAGAAAAAGATACTTCCAAATTTAACAAATAGAAAAATAATTAT
GTTGAGGATTACTTAAATGAAAATTCTGATAGTGAGGATAATATGTATGGTGAAGAATTT
TTTTAAAATGATGCAAAAGAAGAAGAAGAAGAAGTTGGTAATTAAATTTAAAATGACTCT
GATGATCTCAAATTTGATAATAGTGATGAAGAAGTAAATAATCTAAGATAAAATGGAAGT
TTGAATGGAAATACTAAATTTTATTCTGAAAAATTATAAAAATTATAAATGATGAATCAG
CAATAAAATGATGCAGCAGATGACGATGATGTTTTTTTAAGTTTTAATAAATAATAAAAT
TTAAATCAAGCTAATAGCCAGAAATCAAATGGTAACTTAAATACTAATTAAAGTACCTTA
AGTGCCAACAATAACAGCACAATTAAAATATAGACTCTTGATACCTCATAATCAAGTATG
AATAAATCTAATTTCACAAACAACAAAACAATCAATTAATAGTAGTTAGTTGAAGAAGAA
TAAGAATAAGAATCAGATGAAAGTGATCTAGATTTGTATATGAAATAGCTTGAAGAAGAA
GAAAATGCCGCTAAAGGAATATAGACATCATAAAAAAATAGCTCTAGCTAAAATAATACT
AAGCCAAAGCAAACTTACATTACCATGGAAGATATTTTCGGTAAAAAGAAATTCAAAGAA
GATATTGAAGAAGAAGAAAATGAAGAAGGATAGTCTAATAATGAAGATTTTGGAAATTAG
GACAGCAAAAATAAAGTTTATTTTAACGGAGACTCTACTTTTAATTAGCAAAAAATTTAA
GAAGAAGAGGAAGAGGGAGATTAGGATGAGGATGATGAGGAATAAGATAAATTTTACTAA
GCTTTCAAGGAATAATTGCTTAAAACAAAGCAAGAAAAGCTCAAAGATAATAAAGGAGCC
TTAATGATGGATGAAGAATAAGAGAAAGAAGAGGAGAGAGAGGCCTTTTTTGATCCAGAA
AACGGTGAGAGCAAAGAAGACTACATGGAAAGACTTAAAAAGGAAGCTTAAAAAAAGGAA
TTAAAGCCTATTGATTATAATGAAGATGAATTAGAACATTTCTAGAAGAATTTTTATATT
GAAAGCAAAGAAATTTCTCAGATGACTGAGGATGAAGTAAAAATTTATAGAGAAAACTTA
GGTGAGATCCAAGTTAAAGGATAAGAAGTTCCTCGTCCTATAAAATCATGGCTTTAATCT
GGTTTAAGTGATAGAATATTAGAAGTTCTAATTGAAAAGAAAAAGTATGATAAACCTTTT
CCTATTTAATGCTAAAGTCTACCTGTAATTATGAGTGGAAGAGATATGATAGGTATTGCA
GAAACAGGTAGTGGTAAAACACTCGCCTATTTACTTCCTATGATTCGTCACGTATCTGCC
CAAAGACCTCTATAAGAAGGTGATGGACCTATAGGGTTAATTCTTGTTCCAACAAGAGAG
TTAGCTACTTAGATATATCTTGAAGCTAAACCTTTCTTAAAAGCTTATAAATATGAGATA
GTTGCTGTTTTTGGAGGAACTGGCATTAAAGGATAACTTTCTGAATTAAAAAGAGGTTGT
GAAATCGTAGTTGCTACTCCTGGTAGACTTATAGATGTACTCACTACTTCAAATGGCAAA
ATAACTAACTTGAAAAGAATAACAATGGTAGTCATTGATGAGGCAGATAGAATGTTTGAT
TTAGGTTTTGAACCTTAAATTGCAAAGATTCTAGCAACAACTCGTCCTGATAAGTAAACT
GTGCTATTTTCTGCAACTTTCCCAAAAAATGTAGAGAATTTAGCCAAAAAATTAATGAGA
CACAAGCCAGTAGAAGTTGTTGTAGGTGCAAGAGGATAGGCTTGCACAAATATTACTTAA
TTAATAGAAATAAGAGATGAATCTACACGTTTGTTTAGATTATTAGAACTATTAGGTATT
TATACTGAATAGGGTTAAGTTATAATTTTCGTTGATAAATAAATCGAAGTTGATTTTTTG
TATCAAGAATTACGTTCTAGATATTACATTCCTACAATTTTGCATGCAGGTGTTGATGCT
GAAGATAGAGTGAATAATTTACTTGATTTCAGAAAAGGAATTTACAAAATACTTATAGCA
ACCTCTTTAAGTAGCAGAGGGTTGGATGTAAAAAATGTAGTTTTGGTAGTAAACTACAAA
TGTCCTAACCATATAGAAGATTACATCCATAGAATTGGAAGAACTGGTAGAGCAGGAAAT
AAGGGTACTGCTGTAACTTTCATAGGTCCTGAGGAGGACAAATATAGCTTAGATCTTATT
AAGGCTTTAAAGAGAAGTGACCAAAAAGTTCCTGAGGAGCTTTTGAGAATGGGAGAGGAA
TTTAAGAAAAAAGTGAAAATGGGTGAGGCTAAGATTTATAATAATGCAAATATGTAAGGT
AAAGGCTTTAATTTTGATGAAGAAGAAAGAGATAAAATGAATTAGATGAAGTATGAATAA
AAGAAATTCTTAGCACTCTAAATGGGTCTCGATATAGAAGAAAGAGATGACGATTTTGTT
TTTAAGAAAGCTTAAGAAGAAAGTGCAAAAGATAAAAAGGATAAGGATGAATTAACCTTC
TAACAAAAGCTTCATATTGTAAAAACTCAAGATGAGTATAAAGATATTAGGGAAGAACTA
TTTTCTAAAGCAAGTGAAATTGCAAATTAGAAAAAGCTTCTAGGATGCGGCGATGATGAA
ATTAAAAAGGCAATAGAAGATGTTTTCAAAAAAGGTTTAGAAAATTTCATACCAAGTACT
AAGAATATAGATTAAGGTAAGATCAAAATTGCAAAAATGCTTTAAGAATTCGAAAAGTCT
AATGATATTGCCAATAATATTTGTTTTGAAGAGATCGAAATTAACGATTACCCAGAAAAT
GCAAGAAAAGCTGTAACTAAAAGAGATTTCCAAGATAGAATCTATCTCCAAACAGGCTGC
CTTGTCGTTTAAAAGGGTATTTATGTTGAAATAGGCAAGAAAGTTTAACCAGGTTTCTAG
AAACTATATTTAAGAATTGAAGGAGATTCCGAATACTAAGTACGTATGGCTTATAGGGAT
ATCAAAGCAGAGTTAGAAGAAAAATCTATCAAAATACACGAAAGAGGAGGTGCACAGCAA
GGAAGATTCACAATCCCATGA


>TTHERM_00420420(protein)
MMMSLKMMKMINLFNQIKIFKPKETNINSQVIQPIQDQQNDSPRIQLEQDPIMIQIQQQI
EAQAKKQSNQSQNKQNLESPSQPSIENEANRELVENQNEFEEEMILEKDTSKFNKQKNNY
VEDYLNENSDSEDNMYGEEFFQNDAKEEEEEVGNQIQNDSDDLKFDNSDEEVNNLRQNGS
LNGNTKFYSEKLQKLQMMNQQQNDAADDDDVFLSFNKQQNLNQANSQKSNGNLNTNQSTL
SANNNSTIKIQTLDTSQSSMNKSNFTNNKTINQQQLVEEEQEQESDESDLDLYMKQLEEE
ENAAKGIQTSQKNSSSQNNTKPKQTYITMEDIFGKKKFKEDIEEEENEEGQSNNEDFGNQ
DSKNKVYFNGDSTFNQQKIQEEEEEGDQDEDDEEQDKFYQAFKEQLLKTKQEKLKDNKGA
LMMDEEQEKEEEREAFFDPENGESKEDYMERLKKEAQKKELKPIDYNEDELEHFQKNFYI
ESKEISQMTEDEVKIYRENLGEIQVKGQEVPRPIKSWLQSGLSDRILEVLIEKKKYDKPF
PIQCQSLPVIMSGRDMIGIAETGSGKTLAYLLPMIRHVSAQRPLQEGDGPIGLILVPTRE
LATQIYLEAKPFLKAYKYEIVAVFGGTGIKGQLSELKRGCEIVVATPGRLIDVLTTSNGK
ITNLKRITMVVIDEADRMFDLGFEPQIAKILATTRPDKQTVLFSATFPKNVENLAKKLMR
HKPVEVVVGARGQACTNITQLIEIRDESTRLFRLLELLGIYTEQGQVIIFVDKQIEVDFL
YQELRSRYYIPTILHAGVDAEDRVNNLLDFRKGIYKILIATSLSSRGLDVKNVVLVVNYK
CPNHIEDYIHRIGRTGRAGNKGTAVTFIGPEEDKYSLDLIKALKRSDQKVPEELLRMGEE
FKKKVKMGEAKIYNNANMQGKGFNFDEEERDKMNQMKYEQKKFLALQMGLDIEERDDDFV
FKKAQEESAKDKKDKDELTFQQKLHIVKTQDEYKDIREELFSKASEIANQKKLLGCGDDE
IKKAIEDVFKKGLENFIPSTKNIDQGKIKIAKMLQEFEKSNDIANNICFEEIEINDYPEN
ARKAVTKRDFQDRIYLQTGCLVVQKGIYVEIGKKVQPGFQKLYLRIEGDSEYQVRMAYRD
IKAELEEKSIKIHERGGAQQGRFTIP


>TTHERM_00420420(gene)
ATGATGATGAGTCTGAAGATGATGAAAATGATTAACCTATTTAATCAAATAAAAATTTTT
AAGCCTAAAGTAATATTGAACAAACGAAGCAAGTAGAATTAGAATAATAATAATAAATCT
AATAGGAAACAAATATTAATTCGCAAGTAATATAGCCAATTTAAGATTAATAAAATGATT
CTCCCAGAATTTAATTAGAATAGGATCCAATTATGATTTAAATTTAGCAATAAATAGAAG
CTTAGGCTAAGAAATAAAGTAACTAAAGCTAAAACAAATAAAATTTAGAAAGCCCAAGTT
AACCTTCGATAGAAAATGAAGCAAATAGAGAGCTAGTTGAAAACTAAAATGAATTTGAAG
AGGAAATGATTTTAGAAAAAGATACTTCCAAATTTAACAAATAGAAAAATAATTATGTTG
AGGATTACTTAAATGAAAATTCTGATAGTGAGGATAATATGTATGGTGAAGAATTTTTTT
AAAATGATGCAAAAGAAGAAGAAGAAGAAGTTGGTAATTAAATTTAAAATGACTCTGATG
ATCTCAAATTTGATAATAGTGATGAAGAAGTAAATAATCTAAGATAAAATGGAAGTTTGA
ATGGAAATACTAAATTTTATTCTGAAAAATTATAAAAATTATAAATGATGAATCAGCAAT
AAAATGATGCAGCAGATGACGATGATGTTTTTTTAAGTTTTAATAAATAATAAAATTTAA
ATCAAGCTAATAGCCAGAAATCAAATGGTAACTTAAATACTAATTAAAGTACCTTAAGTG
CCAACAATAACAGCACAATTAAAATATAGACTCTTGATACCTCATAATCAAGTATGAATA
AATCTAATTTCACAAACAACAAAACAATCAATTAATAGTAGTTAGTTGAAGAAGAATAAG
AATAAGAATCAGATGAAAGTGATCTAGATTTGTATATGAAATAGCTTGAAGGTAATATAA
ACACTTTTTAGTTATTTTTATTTTATGTTTTATAATATATTATTTTAATATATAGAAGAA
GAAAATGCCGCTAAAGGAATATAGACATCATAAAAAAATAGCTCTAGCTAAAATAATACT
AAGCCAAAGCAAACTTACATTACCATGGAAGATATTTTCGGTAAATCAAACATTTTTAAT
TTTAGAAAGTATAAAAATAAATTGAGAAAAAGAAGTCATGCACTGTTATTTTCATAAATA
GGTAAAAAGAAATTCAAAGAAGATATTGAAGAAGAAGAAAATGAAGAAGGATAGTCTAAT
AATGAAGATTTTGGAAATTAGGACAGCAAAAATAAAGTTTATTTTAACGGAGACTCTACT
TTTAATTAGCAAAAAATTTAAGAAGAAGAGGAAGAGGGAGATTAGGATGAGGATGATGAG
GAATAAGATAAATTTTACTAAGCTTTCAAGGAATAATTGCTTAAAACAAAGCAAGAAAAG
CTCAAAGATAATAAAGGAGCCTTAATGATGGATGAAGAATAAGAGAAAGAAGAGGAGAGA
GAGGCCTTTTTTGATCCAGAAAACGGTGAGAGCAAAGAAGACTACATGGAAAGACTTAAA
AAGGAAGCTTAAAAAAAGGAATTAAAGCCTATTGATTATAATGAAGATGAATTAGAACAT
TTCTAGAAGAATTTTTATATTGAAAGCAAAGAAATTTCTCAGATGACTGAGGATGAAGTA
AAAATTTATAGAGAAAACTTAGGTGAGATCCAAGTTAAAGGATAAGAAGTTCCTCGTCCT
ATAAAATCATGGCTTTAATCTGGTTTAAGTGATAGAATATTAGAAGTTCTAATTGAAAAG
AAAAAGTATGATAAACCTTTTCCTATTTAATGCTAAAGTCTACCTGTAATTATGAGTGGA
AGAGATATGATAGGTAATTAATTAATTTATTTATTTATTCATTTTTGCTAATTTTTATAA
GTAATAGCAGTAGTATAATAGAATCAAGCTTTAAATTAAAAAACAAACATACTACTTAAT
TAATTGCTATCAACACCTTTTTTAAATATTTTGTTTTTATTTTTCTGATTGAATTTTTTA
TTTTTCAGATTTTCTACGTGAGTAGGCCAAGTCTAAAGATAGTAGATCTCATAATAATTA
AACAATATGATCGATATACAAGAAAGAAAAAGCGTATTGAAATAAATATAAGCATAAGGA
TTTGTTTTTGTTTGGCAGAATCATTTATTTGTTTCATTAAAAATGTCTTTTTCATTATAT
CCTTAATTTTATATTTTTATATTATTCTAATAGGTATTGCAGAAACAGGTAGTGGTAAAA
CACTCGCCTATTTACTTCCTATGATTCGTCACGTATCTGCCCAAAGACCTCTATAAGAAG
GTGATGGACCTATAGGGTTAATTCTTGTTCCAACAAGAGAGTTAGCTACTTAGATATATC
TTGAAGCTAAACCTTTCTTAAAAGCTTATAAATATGAGATAGTTGCTGTTTTTGGAGGAA
CTGGCATTAAAGGATAACTTTCTGAATTAAAAAGAGGTTGTGAAATCGTAGTTGCTACTC
CTGGTAGACTTATAGATGTACTCACTACTTCAAATGGCAAAATAACTAACTTGAAAAGAA
TAACAATGGTAGTCATTGATGAGGCAGATAGAATGTTTGATTTAGGTTTTGAACCTTAAA
TTGCAAAGATTCTAGCAACAACTCGTCCTGATAAGTAAACTGTGCTATTTTCTGCAACTT
TCCCAAAAAATGTAGAGAATTTAGCCAAAAAATTAATGAGACACAAGCCAGTAGAAGTTG
TTGTAGGTGCAAGAGGATAGGCTTGCACAAATATTACTTAATTAATAGAAATAAGAGATG
AATCTACACGTTTGTTTAGATTATTAGAACTATTAGGTATTTATACTGAATAGGGTTAAG
TTATAATTTTCGTTGATAAATAAATCGAAGTTGATTTTTTGTATCAAGAATTACGTTCTA
GATATTACATTCCTACAATTTTGCATGCAGGTAATAGATCAATTTACTTAACAGATCAAT
TTAATAAACATTTTATTTATTTATATTTAAATAGGTGTTGATGCTGAAGATAGAGTGAAT
AATTTACTTGATTTCAGAAAAGGAATTTACAAAATACTTATAGCAACCTCTTTAAGTAGC
AGGTAATTAATTAGGTTTTTTTGTTACTTATTAATTTAAAACTATTTTATTAACTAATAG
AGGGTTGGATGTAAAAAATGTAGTTTTGGTAGTAAACTACAAATGTCCTAACCATATAGA
AGATTACATCCATAGAATTGGAAGAACTGGTAGAGCAGGAAATAAGGGTACTGCTGTAAC
TTTCATAGGTCCTGAGGAGGTATTTCATTTTTTAAAAATTAATTTTGACTATTAATTCAA
TTAACTTTCAATTATTTAATTTAAGTAAAATTGATTTTTATGTTTCATTTTTATTTTTTA
AATAATATAGGACAAATATAGCTTAGATCTTATTAAGGCTTTAAAGAGAAGTGACCAAAA
AGTTCCTGAGGAGCTTTTGAGAATGGGAGAGGAATTTAAGAAAAAAGTGAAAATGGGTGA
GGCTAAGATTTATAATAATGCAAATATGTAAGGTAAAGGCTTTAATTTTGATGAAGAAGA
AAGAGATAAAATGAATTAGATGAAGTATGAATAAAAGAAATTCTTAGCACTCTAAATGGG
TCTCGATATAGAAGAAAGAGATGACGATTTTGTTTTTAAGAAAGCTTAAGAAGAAAGTGC
AAAAGATAAAAAGGATAAGGATGAATTAACCTTCTAACAAAAGCTTCATATTGTAAAAAC
TCAAGATGAGTATAAAGATATTAGGGAAGAACTATTTTCTAAAGCAAGTGAAATTGCAAA
TTAGAAAAAGCTTCTAGGATGCGGCGATGATGAAATTAAAAAGGCAATAGAAGATGTTTT
CAAAAAAGGTTTAGAAAATTTCATACCAAGTACTAAGAATATAGATTAAGGTAAGATCAA
AATTGCAAAAATGCTTTAAGAATTCGAAAAGTCTAATGATATTGCCAATAATATTTGTTT
TGAAGAGATCGAAATTAACGATTACCCAGAAAATGCAAGAAAAGCTGTAACTAAAAGAGA
TTTCCAAGATAGAATCTATCTCCAAACAGGCTGCCTTGTCGTTTAAAAGGGTATTTATGT
TGAAATAGGCAAGAAAGTTTAACCAGGTTTCTAGAAACTATATTTAAGAATTGAAGGAGA
TTCCGAATACTAAGTACGTATGGCTTATAGGGATATCAAAGCAGAGTTAGAAGAAAAATC
TATCAAAATACACGAAAGAGGAGGTGCACAGCAAGGAAGATTCACAATCCCATGA