Identifiers and Description

Gene Model Identifier

TTHERM_01197120

Standard Name

DRH18 (DExD/H box RNA helicase 18)

Aliases

PreTt23654 | 271.m00043

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01197120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_168290
Tetrahymena borealisEI9_20999.19.997093137033517e-262hypothetical protein (404 aa)
OxytrichaContig2122.0.g989.997093137033517e-262DEAD/DEAH box helicase
WormBaseWBGene000020831.9999987447608204e-178locus:inf-1 Eukaryotic initi
ation factor 4A status:Confi
rmed UniProt:P27639 protei
n_id:CCD70313.1
DictyBaseDDB_G02691925.001736064328732e-162tifA on chromosome: 1 position
3537960 to 3539386
SGDYDR021W2.999720831252636e-153FAL1 Nucleolar protein require
d for maturation of 18S rRNA,
member of the eIF4A subfamily
of DEAD-box ATP-dependent RNA
helicases

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01197120(coding)
ATGAGCGAGGAACAAAAGGAAGTAAAACAAGAAAAGACTACCGATATTGAAACCAACTGG
TTCGAATCTGTTGATTCTTTCCACAAGTTATAACTTAAGGAAGATCTCCTCAGAGGTATC
TATGGTTATGGTTTCGAAAAGCCCTCCCCCATCCAACAATGCGGTATTATCCCTATCATT
AAGGGTAAAGATACTATCGCCCAAGCCCAATCTGGTACTGGTAAGACTGCTACTTTCTCT
ATTGCCACTTTATAAGTCATCGACACTAGCTCTCCCCACACTTAAGCTTTGATTCTTGCC
CCCACCAGAGAATTAGCCCAATAAACTATCACCGTTATTATGTACTTAGGTGAATTCTTG
AAGGTCTCCGCCTATGCTTGCACTGGTGGTACTGATCCCAAGGAAGATAGAAAGAGATTA
AGAGAAGGTGTCCAAGTTGTTGTTGGTACCCCTGGTAGAGTTTTGGATTTAATCTAAAAG
AAGACTTTAGTCACCGATCACTTAAAATTATTCATTTTGGACGAAGCCGATGAAATGTTA
GGAAGAGGTTTCAAGGATCAAATTAACAAAATCTTCTAAAACTTACCCCACGATATCTAG
GTTGCTCTTTTCTCTGCTACCATGGCTCCCGAAATTCTTGAAATTACCAAGTAATTTATG
AGAGACCCCGCTACTATCCTTGTCAAGAATGATGACTTGACTTTGGACGGTATTAAATAA
TTCTACATCGCCTTAGATAAGGAAGAATGGAAGTTTGACACCTTAGTCGAATTATACAAT
AACATCGAAATCGCTTAAGCTATTATCTATTGCAACACCAAGAAGAGAGTCGATGAATTA
AGAGACAAGCTTATTGAAAAGAATATGACCGTCTCTGCTATGCACGGTGAAATGGACCAA
TAAAACAGAGATCTTATTATGAAGGAATTCAGAACCGGTACCTCCAGAGTTCTTATCACT
ACTGATTTGCTCTCCAGAGGTATTGATATCCATCAAGTCAACTTGGTTATCAACTACGAC
TTACCCCTTAAGAAGGAATCTTATATTCACAGAATCGGTAGATCTGGTCGTTTCGGTAGA
AAGGGTGTTGCCATCAACTTCGTCGTCCCTGCTGATGCTAAGTTCCTTAAGGAAACTGAA
AAGTATTATCAAACTCAAATTGTTGAAATGCCTCTCGATGTCTCTCAAATCTACGAGTGA


>TTHERM_01197120(protein)
MSEEQKEVKQEKTTDIETNWFESVDSFHKLQLKEDLLRGIYGYGFEKPSPIQQCGIIPII
KGKDTIAQAQSGTGKTATFSIATLQVIDTSSPHTQALILAPTRELAQQTITVIMYLGEFL
KVSAYACTGGTDPKEDRKRLREGVQVVVGTPGRVLDLIQKKTLVTDHLKLFILDEADEML
GRGFKDQINKIFQNLPHDIQVALFSATMAPEILEITKQFMRDPATILVKNDDLTLDGIKQ
FYIALDKEEWKFDTLVELYNNIEIAQAIIYCNTKKRVDELRDKLIEKNMTVSAMHGEMDQ
QNRDLIMKEFRTGTSRVLITTDLLSRGIDIHQVNLVINYDLPLKKESYIHRIGRSGRFGR
KGVAINFVVPADAKFLKETEKYYQTQIVEMPLDVSQIYE


>TTHERM_01197120(gene)
ATGAGCGAGGAACAAAAGGAAGTAAAACAAGAAAAGACTACCGATATTGAAACCAACTGG
TTCGAATCTGTTGATTCTTTCCACAAGTTATAACTTAAGGAAGATCTCCTCAGAGGTATC
TATGGTAAGAGATTCATTTTCTAATATCGATTTAAATAACCTACTTCAATTCAAATTTCT
TCTCATTCGTTCTGAGCAATTTTTAACCAAGTGAAGCAAACTGACTTGACTCTGTAATAA
AAACAAAAGAAGTATAATAAATGGTTCTTCATAATTAAGTTTTGAAGAAATAAGTTTAAA
ATATTTTTGGGTTTTGTCTTAGAGGGCATGAAATGGCTTTGTGTATAGTAAAAACACTTC
TTAATACTTGAACAGCTAAGAAGGTTGTTTGCCTATAGGAAAAATATGTGATAAAAAATG
CCTAAACTTCAATTTCTTTAATGCATTTTTATTCAGGTTTAATCCCTTGTTAAAAATATA
TCTGTTGAACAACATGATTTTGTTTAAAAAAACTATAATTCTGAAGCATGATGTAAAACT
AGCTAACAAACTAACTAACTAATATCACAGCATAAATATTCCAACAACAAAAATTTTAGA
TTTGCTAGTAAAAAATAATAGCTCAGATTAATAAAATGTTTTGAGTTAAAAAATAAATGA
TGATCTTGGTTGAGAAAAGCTTTAATTAATGAGAATTAGAAGAATTTTAAAAATTTATTT
CATTAAATAACTTAAGCTAAATATTATTTTATTAAATAGGTTATGGTTTCGAAAAGCCCT
CCCCCATCCAACAATGCGGTATTATCCCTATCATTAAGGGTAAAGATACTATCGCCCAAG
CCCAATCTGGTACTGGTAAGACTGCTACTTTCTCTATTGCCACTTTATAAGTCATCGACA
CTAGCTCTCCCCACACTTAAGCTTTGATTCTTGCCCCCACCAGAGAATTAGCCCAATAAA
CTATCACCGTAAGAAGAATTTTTAATATTATAAAGCAAACACAAACATATATACATTCAT
ACGTAGTTAGTCTTTATACTTTTAGAGAATTTTTTTCATTTTAGGAGTTAATCTTAAAAG
AAATAATCTTTCTCTTTTAGAAAAAGTCTAATATATCAGAGAGTATCTTTCTTTCACTTT
GTTGTATGTAACAGAATAGTCAAGCGAAAGATCTCTTTATAATTTAAATAGCATAGCAAT
TAATTACTTAGCAGCAAAATATTAAGAATATTTTTTAAATAAAAAGGTTATTATGTACTT
AGGTGAATTCTTGAAGGTCTCCGCCTATGCTTGCACTGGTGGTACTGATCCCAAGGAAGA
TAGAAAGAGATTAAGAGAAGGTGTCCAAGTTGTTGTTGGTACCCCTGGTAGAGTTTTGGA
TTTAATCTAAAAGAAGACTTTAGTCACCGATCACTTAAAATTATTCATTTTGGACGAAGC
CGATGAAATGTTAGGAAGAGGTTTCAAGGATCAAATTAACAAAATCTTCTAAAACTTACC
CCACGATATCTAGGTTGCTCTTTTCTCTGCTACCATGGCTCCCGAAATTCTTGAAATTAC
CAAGTAATTTATGAGAGACCCCGCTACTATCCTTGTCAAGAATGATGACTTGACTTTGGA
CGGTATTAAATAATTCTACATCGCCTTAGATAAGGAAGAATGGAAGTTTGACACCTTAGT
CGAATTATACAATAACATCGAAATCGCTTAAGCTATTATCTATTGCAACACCAAGAAGAG
AGTCGATGAATTAAGAGACAAGCTTATTGAAAAGAATATGACCGTCTCTGCTATGCACGG
TGAAATGGACCAATAAAACAGAGATCTTATTATGAAGGAATTCAGAACCGGTACCTCCAG
AGTTCTTATCACTACTGATTTGCTCTCCAGAGGTATTGATATCCATCAAGTCAACTTGGT
TATCAACTACGACTTACCCCTTAAGAAGGAATCTTATATTCACAGAATCGGTAGATCTGG
TCGTTTCGGTAGAAAGGGTGTTGCCATCAACTTCGTCGTCCCTGCTGATGCTAAGTTCCT
TAAGGAAACTGAAAAGTATTATCAAACTCAAATTGTTGAAATGCCTCTCGATGTCTCTCA
AATCTACGAGTGA