Identifiers and Description

Gene Model Identifier

TTHERM_00371290

Standard Name

DRH17 (DExD/H box RNA helicase 17)

Aliases

PreTt28645 | 39.m00218 | 3693.m00065

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family
  • ( PF09006 ) Lung surfactant protein D coiled-coil

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00371290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12273.19.997093137033517e-262DEAD/DEAH box helicase (664 aa
)
DictyBaseDDB_G02775279.997652352281279e-57ddx20 on chromosome: 2 positio
n 8128317 to 8130866
WormBaseWBGene000020835.0007856079333316e-54locus:inf-1 Eukaryotic initi
ation factor 4A status:Confi
rmed UniProt:P27639 protei
n_id:CCD70313.1
SGDYDR021W1.999385218781115e-51FAL1 Nucleolar protein require
d for maturation of 18S rRNA,
member of the eIF4A subfamily
of DEAD-box ATP-dependent RNA
helicases
OxytrichaContig2122.0.g989.996696112986116e-50DEAD/DEAH box helicase
Stentor CoeruleusSteCoe_168291.4251640827409352e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00371290(coding)
ATGAATTAACAAGACAACTTCAACACAGAAATCTCTCATAAATAAATAAAATCTTTTCAC
TAACTTAAATTATCTTCAGGAGACTATTTACGTGCATTAGAGAAGCTACACTTTACCGAG
CCAACTCCAATTTAAATACTTTCAATACCTGAAGGTTTGACAGAAAAGAACATTATTGCA
TAGGCTAAAGCAGGAACAGGAAAAACTTTAGCTTTTAGCAGTATTATACTCGAAAAATTG
ATAAATAGGAGGCAAACAATATTTTAAGATTCAAATCCATTAGTCTTAATTATATTACCT
ACAAGAGAGTTAGCAATTCAGGTATTCGAATTTATTCAGCAACTATTAAAGGCTCTAAAT
ACTATAAATCCTAATTTATTACCTTATGTTAATTGCGGAATCTTTATTGGAGGACTACCA
CTGCAAGATGATAGGAGAAATCTCAAAATACAGCATGTAAAAATAATAATTGGAACAATA
GGAAGAATTGTAGCTCTAATAAAAGAAAATTCATTGGTACTTTCTTCAATAAACACCCTT
GTGCTAGATGAGGCAGATAAACTAATGGGATAAAAAGACTTTTACAAACACATAACTTAT
ATATTTGATGCTTTAAATAAGTAGACTCTAAATAATATATCTATTAGTAGTTAATTAGAT
ATCAACAGTAATATAGAAGAATTAAAGTCATAATAAGAATAAACTCTAATTTAAGATGAA
AAAGAAACTGCTTTTGAAGTTCTTCAAAGGAGGAAAAAAAACTTAAAGTTACCTGTTTAA
TACTTAGCTTATTCGGCAACTTACCCTGATGATCTCAAATAAAAAATTGAGAAATTGATG
GAAACAAGTGTATTTGTAGACGCAATTTAATTATAAAATTAAAGTGATTCACAGAGCACT
GAAAATTAACAGAATGATAATAGAGATTTGAATCTAGAAAATATCATTTAATATAGAGTT
GATGTAAAATAGGAAGGAAATGTTTCAGTAACAAAACAAAAAATAAATATTCTCACAAGT
GTTTTAAAGTAGATTAAGTTTAATCAAGCAATAATATTTTACAATGATAAAATCAAAGGA
GAAAATATTTTTAGTGAACTTAAAGCTTAAAATTATTCTGTTATCTTTATTCATGGAGAT
TAAACTTAGGCAGATAGAATCAAAGTTATGAACTAAATTCGTAGAAATAAAACTTAAATT
ATAATTTCTACTGACTTACTTTCAAGAGGTATTGACATCACTACTATTGATTTAGTTATA
AATTATGACATACCCTCTTCTGTTGAAACATACTATCATAGGATAGGGAGAACTGGAAGG
TATGGAAGATTTGGGATAAGTATAATTTTGGTTCAATAAAATGAAGAAAATTTTATTCAG
TAAAATATAATACATTTTTGCAGATTATAAGACCTGCCTTAAAATTTCTCTGATATAAAT
TTAAGACTGGAATAGAAGCTAGCTGATCTTAACTAAGGTAACAATCTAAAATAATCGGAG
AATTAGTCATTGGAGAAACAAGAAAAAAGTCTATCATCCAACTAAAAGAAAAATCTAAAG
AATAATCCTTAAAACTATCACCATGAATTTACTCAAGGAATACTAATGAAAGAAGTAGAT
GTCAATGAAAAGTTTTACGATGAATCTACTTTTAAATATTTTGAGGAAGAAGAATGCTCA
CCCATTTTGCTAAATGGATAAACTGAACTCTCAGGATCCATGTTTTCAGATGAAGATGAT
ATAGATAATGATATTGAAGAAGAAGAAGATGATGATTATTCATATGAAAATTAAGATGAA
TCAAGTCTTGAAAAATAAGCAGCAGATATTAAAGGTGAAAAATAAAATATAATTTCTAAT
AAAAAAAATCATATTTGCTAAGATAAAAGTGAATGGGGATTCCTTTCATGCTAGGTTTGC
TACGAATTTCTTTTAGAGTCAGAACATTATTTAAATAAAAAATTTGAAATAACAAAGTAC
TTTAATGTAAAAAAAGTTAAATAAATTAAAGCTGATTGA


>TTHERM_00371290(protein)
MNQQDNFNTEISHKQIKSFHQLKLSSGDYLRALEKLHFTEPTPIQILSIPEGLTEKNIIA
QAKAGTGKTLAFSSIILEKLINRRQTIFQDSNPLVLIILPTRELAIQVFEFIQQLLKALN
TINPNLLPYVNCGIFIGGLPLQDDRRNLKIQHVKIIIGTIGRIVALIKENSLVLSSINTL
VLDEADKLMGQKDFYKHITYIFDALNKQTLNNISISSQLDINSNIEELKSQQEQTLIQDE
KETAFEVLQRRKKNLKLPVQYLAYSATYPDDLKQKIEKLMETSVFVDAIQLQNQSDSQST
ENQQNDNRDLNLENIIQYRVDVKQEGNVSVTKQKINILTSVLKQIKFNQAIIFYNDKIKG
ENIFSELKAQNYSVIFIHGDQTQADRIKVMNQIRRNKTQIIISTDLLSRGIDITTIDLVI
NYDIPSSVETYYHRIGRTGRYGRFGISIILVQQNEENFIQQNIIHFCRLQDLPQNFSDIN
LRLEQKLADLNQGNNLKQSENQSLEKQEKSLSSNQKKNLKNNPQNYHHEFTQGILMKEVD
VNEKFYDESTFKYFEEEECSPILLNGQTELSGSMFSDEDDIDNDIEEEEDDDYSYENQDE
SSLEKQAADIKGEKQNIISNKKNHICQDKSEWGFLSCQVCYEFLLESEHYLNKKFEITKY
FNVKKVKQIKAD


>TTHERM_00371290(gene)
ATGAATTAACAAGACAACTTCAACACAGAAATCTCTCATAAATAAATAAAATCTTTTCAC
TAACTTAAATTATCTTCAGGAGACTATTTACGTGCATTAGAGAAGCTACACTTTACCGAG
CCAACTCCAATTTAAATACTTTCAATACCTGAAGGTTTGACAGAAAAGAACATTATTGCA
TAGGCTAAAGCAGGAACAGGAAAAACTTTAGCTTTTAGCAGTATTATACTCGAAAAATTG
ATAAATAGGAGGCAAACAATATTTTAAGATTCAAATCCATTAGTCTTAATTATATTACCT
ACAAGAGAGTTAGCAATTCAGGTATTCGAATTTATTCAGCAACTATTAAAGGCTCTAAAT
ACTATAAATCCTAATTTATTACCTTATGTTAATTGCGGAATCTTTATTGGAGGACTACCA
CTGCAAGATGATAGGAGAAATCTCAAAATACAGCATGTAAAAATAATAATTGGAACAATA
GGAAGAATTGTAGCTCTAATAAAAGAAAATTCATTGGTACTTTCTTCAATAAACACCCTT
GTGCTAGATGAGGCAGATAAACTAATGGGATAAAAAGACTTTTACAAACACATAACTTAT
ATATTTGATGCTTTAAATAAGTAGACTCTAAATAATATATCTATTAGTAGTTAATTAGAT
ATCAACAGTAATATAGAAGAATTAAAGTCATAATAAGAATAAACTCTAATTTAAGATGAA
AAAGAAACTGCTTTTGAAGTTCTTCAAAGGAGGAAAAAAAACTTAAAGTTACCTGTTTAA
TACTTAGCTTATTCGGCAACTTACCCTGATGATCTCAAATAAAAAATTGAGAAATTGATG
GAAACAAGTGTATTTGTAGACGCAATTTAATTATAAAATTAAAGTGATTCACAGAGCACT
GAAAATTAACAGAATGATAATAGAGATTTGAATCTAGAAAATATCATTTAATATAGAGTT
GATGTAAAATAGGAAGGAAATGTTTCAGTAACAAAACAAAAAATAAATATTCTCACAAGT
GTTTTAAAGTAGATTAAGTTTAATCAAGCAATAATATTTTACAATGATAAAATCAAAGGA
GAAAATATTTTTAGTGAACTTAAAGCTTAAAATTATTCTGTTATCTTTATTCATGGAGAT
TAAACTTAGGCAGATAGAATCAAAGTTATGAACTAAATTCGTAGAAATAAAACTTAAATT
ATAATTTCTACTGACTTACTTTCAAGAGGTATTGACATCACTACTATTGATTTAGTTATA
AATTATGACATACCCTCTTCTGTTGAAACATACTATCATAGGATAGGGAGAACTGGAAGG
TAAAAAATTATATTCTTATTTCAAAAAAACTGGTCAAGAAGAACAATGAATAATAAAAAA
TAATATTTTTTATAGCATTTTAGAAACAGCCACATTTTCAATATTTTTTTATTAGAAAGA
TAATTAGAGGCCTGATTTTTTAATTTTTAAATGCACATAAAGAAAATTTTATATTTTTGG
ATTAAATAAAAATGAATTTATTGTTGAAAAAAGCATAAAATGATATGAAAAATACTTTTT
TTAAAAATTATCATGTATAAAATAGGTATGGAAGATTTGGGATAAGTATAATTTTGGTTC
AATAAAATGAAGAAAATTTTATTCAGTAAAATATAATACATTTTTGCAGATTATAAGACC
TGCCTTAAAATTTCTCTGATATAAATTTAAGACTGGAATAGAAGCTAGCTGATCTTAACT
AAGGTAACAATCTAAAATAATCGGAGAATTAGTCATTGGAGAAACAAGAAAAAAGTCTAT
CATCCAACTAAAAGAAAAATCTAAAGAATAATCCTTAAAACTATCACCATGAATTTACTC
AAGGAATACTAATGAAAGAAGTAGATGTCAATGAAAAGTTTTACGATGAATCTACTTTTA
AATATTTTGAGGAAGAAGAATGCTCACCCATTTTGCTAAATGGATAAACTGAACTCTCAG
GATCCATGTTTTCAGATGAAGATGATATAGATAATGATATTGAAGAAGAAGAAGATGATG
ATTATTCATATGAAAATTAAGATGAATCAAGTCTTGAAAAATAAGCAGCAGATATTAAAG
GTGAAAAATAAAATATAATTTCTAATAAAAAAAATCATATTTGCTAAGATAAAAGTGAAT
GGGGATTCCTTTCATGCTAGGTTTGCTACGAATTTCTTTTAGAGTCAGAACATTATTTAA
ATAAAAAATTTGAAATAACAAAGTACTTTAATGTAAAAAAAGTTAAATAAATTAAAGCTG
ATTGA