Identifiers and Description

Gene Model Identifier

TTHERM_00497150

Standard Name

DRH16 (DExD/H box RNA helicase 16)

Aliases

PreTt06881 | 62.m00165 | 3715.m00026

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF08544 ) GHMP kinases C terminal
  • ( TIGR00643 ) ATP-dependent DNA helicase RecG
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family
  • ( TIGR00486 ) conserved hypothetical protein TIGR00486

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00497150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000152329.997093137033517e-262status:Confirmed UniProt:O61
815 protein_id:CCD62102.1
Tetrahymena borealisEI9_12764.19.997093137033517e-262DEAD/DEAH box helicase (644 aa
)
DictyBaseDDB_G02827419.997093137033517e-262ddx18 on chromosome: 3 positio
n 6230156 to 6232041
OxytrichaContig17328.0.g289.997093137033517e-262DEAD/DEAH box helicase
SGDYMR290C9.997093137033517e-262HAS1 ATP-dependent RNA helicas
e; localizes to both the nucle
ar periphery and nucleolus; hi
ghly enriched in nuclear pore
complex fractions; constituent
of 66S pre-ribosomal particle
s
Stentor CoeruleusSteCoe_82121.1379798735078682e-50

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00497150(coding)
ATGGGAGGAAAGGAATTCAAAAAAATGAAGAAAGAGCTTAAGAAAGAGAAGCTCAAATAA
AAGAGCAAGCATTAAGAAGATGCTGTTGATGAGGAAGTTGAAGATGAAATTGAAAACGAA
TAAGATGAAGATGAATAAATATAGAATAAAAAAGTAGAAAAGTAGGGTAAAAAGATAAAG
AAAGATAAAAAGAATAAAAAGGATTTGAAAAAGGCTAAGAAGCAAGCTTAGGCTGAAGAT
GACGATGAAGAAGAATAAGAACAAGAAGAAGAAGATGAAGATCAAATTGAAGAAGAAGTT
CAAGATGATTAATAACCAAATATTGTATTTGATGATGAAAAAGATAATGTAAAAATTACT
TCTTCCAACATGAATAAATATTTGTCTGATGAATCTAAAGCCACTGAATAATAAGATGCT
CCTACTTCTAGAGCTGGATTCTTCTCAAATGATTTGTTTGACGATTTAGAAGTTTGCAAG
CCTACTAAGGATGCTTTAAAGCAAATGAAATTCACAAACATGACTCACATTTAATCAAGA
ACTATTCCTCATTTACTTAAGGGCAGAGATGTTTTAGGAGCTGCTAAGACTGGTAGTGGT
AAAACTTTAGCTTTCTTAATTCCTGCAATTGAAATGCTTTACAAAACCAACTTTGTTCAA
TCTATGGGAACTGGTATTATAGTTATTACTCCTACTAGAGAATTGGCTACTTAAATTTAT
GATGTCGCTAAATAACTTATGTTCTTCCACAGCAAAACCCTCGGTTTGCTTATTGGTGGT
GCAAACAGAAAGGCCGAAGCTATTAAATTGAAAACTGGTGTAAATATGATCATTGCTACT
CCTGGTAGATTACTTGATCACTTATAAAATACTGCAGGATTTGCTTATCACAACTTATTG
GGATTAATTATTGATGAAGCTGATGCTATTTTAAGAATTGGTTTCTAAGAAGAATTAACA
GAAATTTTGAAGCTTCTTCCTATTGACAGATAGACTGTTTTATTCTCTGCTACCTAAAAC
AAAAAGATTGATGATTTAGCTAGACTATCTCTCAAATAGCCTATATATATTGGTGTTGAT
GATGTTGCTGAAACTTCCACAGTTGAAGGATTAGAACAAGGTTACGTTATCATAGATGCA
GACAAGAAATTTAGATTACTATTTACTTTCTTATAAAAGCAAAAGAAGAAGAAAGTTATG
GTTTTCTTCAGTTCTTGCAATTCAGTTAAGTTCCACTCTGATCTTTTAAATTATGTTGAT
ATTCCCGTCTTGGACATTCATGGAAAATAAAAGTAACAAAAGAGATTAAATACATTCTAC
GAATTCTCAAATGCTACTTCTGGTGTATTATTGTGCACTGATGTTGCAGCTAGAGGTTTG
GATATTCCTAACGTTGATTGGATTGTTTAATACGATCCTCCTGATGATACTAAGGAATAT
ATTCACAGAGTAGGTCGTACTTGTAGAGGTGCTAACACAACTGGTAAGGCTTTGCTTTTC
TTGCTTCCTGAAGAAAAGGATTACTTAAAGTACTTAAAGGCTGCTAAAGTAAATTTGAAT
GAATACGAATTCCCTGAAAACAAACTTGCCAATATCCAAGATTAATTTGATAAGTTGGTT
GAAAGAAATTATTTCTTGAATAGATGTGCATTTGAAGCATTTAGATCTTACTTACATTCT
TACTCTGCTCACAGTTTAAAGGACATATTCGATGTTGCTAATCTTGACTTATAAAAGATT
GGACGCTCCTTTGGTTTTAAGATCCCTCCTAGAGTTAATTTAAATGTTAAAGTAAGCAGC
AAGACCTAAAGAAAAAATAAAGTTAAATAAATAAGTGACTCTAAGACAGGCAAGAAAAGT
GGTTTTTAAATGAGAGATAAAAAGTTATTACAAAAGAAATAAGGTGATGGCAGACAATTT
AGCCGTTGA


>TTHERM_00497150(protein)
MGGKEFKKMKKELKKEKLKQKSKHQEDAVDEEVEDEIENEQDEDEQIQNKKVEKQGKKIK
KDKKNKKDLKKAKKQAQAEDDDEEEQEQEEEDEDQIEEEVQDDQQPNIVFDDEKDNVKIT
SSNMNKYLSDESKATEQQDAPTSRAGFFSNDLFDDLEVCKPTKDALKQMKFTNMTHIQSR
TIPHLLKGRDVLGAAKTGSGKTLAFLIPAIEMLYKTNFVQSMGTGIIVITPTRELATQIY
DVAKQLMFFHSKTLGLLIGGANRKAEAIKLKTGVNMIIATPGRLLDHLQNTAGFAYHNLL
GLIIDEADAILRIGFQEELTEILKLLPIDRQTVLFSATQNKKIDDLARLSLKQPIYIGVD
DVAETSTVEGLEQGYVIIDADKKFRLLFTFLQKQKKKKVMVFFSSCNSVKFHSDLLNYVD
IPVLDIHGKQKQQKRLNTFYEFSNATSGVLLCTDVAARGLDIPNVDWIVQYDPPDDTKEY
IHRVGRTCRGANTTGKALLFLLPEEKDYLKYLKAAKVNLNEYEFPENKLANIQDQFDKLV
ERNYFLNRCAFEAFRSYLHSYSAHSLKDIFDVANLDLQKIGRSFGFKIPPRVNLNVKVSS
KTQRKNKVKQISDSKTGKKSGFQMRDKKLLQKKQGDGRQFSR


>TTHERM_00497150(gene)
ATGGGAGGAAAGGAATTCAAAAAAATGAAGAAAGAGCTTAAGAAAGAGAAGCTCAAATAA
AAGAGCAAGCATTAAGAAGATGCTGTTGATGAGGAAGTTGAAGATGAAATTGAAAACGAA
TAAGATGAAGATGAATAAATATAGAATAAAAAAGTAGAAAAGTAGGGTAAAAAGATAAAG
AAAGATAAAAAGAATAAAAAGGATTTGAAAAAGGCTAAGAAGCAAGCTTAGGCTGAAGAT
GACGATGAAGAAGAATAAGAACAAGAAGAAGAAGATGAAGATCAAATTGAAGAAGAAGTT
CAAGATGATTAATAACCAAATATTGTATTTGATGATGAAAAAGATAATGTAAAAATTACT
TCTTCCAACATGAATAAATATTTGTCTGATGAATCTAAAGCCACTGAATAATAAGATGCT
CCTACTTCTAGAGGTACATATAACATTATTTTATTTTATTGTAAATGAAACCCTAAAATT
TTTATTTGTCAATATTTTAGCTGGATTCTTCTCAAATGATTTGTTTGACGATTTAGAAGT
TTGCAAGCCTACTAAGGATGCTTTAAAGCAAATGAAATTCACAAACATGACTCACATTTA
ATCAAGAACTATTCCTCATTTACTTAAGGGCAGAGATGTTTTAGGAGCTGCTAAGACTGG
TAGTGGTAAAACTTTAGCTTTCTTAATTCCTGCAATTGAAATGCTTTACAAAACCAACTT
TGTTCAATCTATGGGAACTGGTATTATAGTTATTACTCCTACTAGAGAATTGGCTACTTA
AATTTATGATGTCGCTAAATAACTTATGTTCTTCCACAGCAAAACCCTCGGTTTGGTAAA
AATTATAAACACTTTTACTTATTCAAAATAGCTTCTTTTTCTTAGATTATATATAGCATA
ACTTTTTTAGGGTGTTTGTTTAAAATAAATTCATTTTAGCTAAGTTTAAAATAGCAGATT
AAATAATATTTTTTTAATTAATAATTTTAGCTTATTGGTGGTGCAAACAGAAAGGCCGAA
GCTATTAAATTGAAAACTGGTGTAAATATGATCATTGCTACTCCTGGTAGATTACTTGAT
CACTTATAAAATACTGCAGGATTTGCTTATCACAACTTATTGGGATTAATTATTGATGAA
GCTGATGCTATTTTAAGAATTGGTTTCTAAGAAGAATTAACAGAAATTTTGAAGCTTCTT
CCTATTGACAGATAGACTGTTTTATTCTCTGCTACCTAAAACAAAAAGATTGATGATTTA
GCTAGACTATCTCTCAAATAGCCTATATATATTGGTGTTGATGATGTTGCTGAAACTTCC
ACAGTTGAAGGATTAGAACAAGGTTACGTTATCATAGATGCAGACAAGAAATTTAGATTA
CTATTTACTTTCTTATAAAAGCAAAAGAAGAAGAAAGTTATGGTTTTCTTCAGTTCTTGC
AATTCAGTTAAGTTCCACTCTGATCTTTTAAATTATGTTGATATTCCCGTCTTGGACATT
CATGGAAAGTAATTATTTTGCATATTAATAGACTAGTTGTGTCATTTAAATTTATTTACT
AGTAAATTATAAAACTAAATTTGTTTTTTTAATAGATAAAAGTAACAAAAGAGATTAAAT
ACATTCTACGAATTCTCAAATGCTACTTCTGGTGTATTATTGTGCACTGATGTTGCAGCT
AGAGGTTTGGATATTCCTAACGTTGATTGGATTGTTTAATACGATCCTCCTGATGATACT
AAGGAATATATTCACAGAGTAGGTCGTACTTGTAGAGGTGCTAACACAACTGGTAAGGCT
TTGCTTTTCTTGCTTCCTGAAGAAAAGGATTACTTAAAGTACTTAAAGGCTGCTAAAGTA
AATTTGAATGAATACGAATTCCCTGAAAACAAACTTGCCAATATCCAAGATTAATTTGAT
AAGTTGGTTGAAAGAAATTATTTCTTGAATAGATGTGCATTTGAAGCATTTAGATCTTAC
TTACATGTAATAATTTAAAATTTATTTATTTTAAAAATGAATATAAAATTTATTTTTTTA
ATAAAGTCTTACTCTGCTCACAGTTTAAAGGACATATTCGATGTTGCTAATCTTGACTTA
TAAAAGATTGGACGCTCCTTTGGTTTTAAGATCCCTCCTAGAGTTAATTTAAGTAATTAT
TATAAAAAAAAGGTATAAAAGTAATTAAAATGAATATTATAAAAATAATTTAGATGTTAA
AGTAAGCAGCAAGACCTAAAGAAAAAATAAAGTTAAATAAATAAGTGACTCTAAGACAGG
CAAGAAAAGTGGTTTTTAAGTAAAAATATGATTAATAAAAAAATTTAATTAATTTCTAAT
TTATAAAATAGATGAGAGATAAAAAGTTATTACAAAAGAAATAAGGTGATGGCAGACAAT
TTAGCCGTTGA