Identifiers and Description

Gene Model Identifier

TTHERM_00923120

Standard Name

DRH15 (DExD/H box RNA helicase 15)

Aliases

PreTt21191 | 164.m00084

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00098 ) Zinc knuckle
  • ( TIGR02801 ) protein TolR
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF00176 ) SNF2 family N-terminal domain
  • ( TIGR01389 ) ATP-dependent DNA helicase RecQ
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00923120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13236.19.997093137033517e-262helicase domain-containing pro
tein (569 aa)
DictyBaseDDB_G02873611.0003913505156363e-175ddx41 on chromosome: 5 positio
n 183547 to 185657
WormBaseWBGene000192459.998061997456677e-175locus:sacy-1 status:Confirme
d UniProt:Q9N5K1 protein_i
d:CCD72466.1
SGDYNL112W8.001734810345018e-90DBP2 Essential ATP-dependent R
NA helicase of the DEAD-box pr
otein family, involved in nons
ense-mediated mRNA decay and r
RNA processing
OxytrichaContig21312.0.g805.0023264312997875e-87DEAD/DEAH box helicase
Stentor CoeruleusSteCoe_78992.0842828425817514e-52

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00923120(coding)
ATGTAGAATTCAAATTAAAATGTATCGAAAGTCACTTTCGATGATTTAAAATCAAATTAA
AAGTCTCTCCTTGAAAAGGCGCAGGAATTGAAGTCAAAACATGTAGAGCAATATGTAGAA
GAGGAAGAAATAGAAGTTGAAGACCCAGAACTAGATAATATGAACTTTATGACAGTAGTT
AAAAATACTGCTTTAGGAGGACTGATTGAAAGGAAGGAATAAATTAAAGAAAGGGTGAAA
ACTACATGGAGAATACCCAAGGCTTATAGGACAGTTACTTAGAGGGAGATTTAAAAAGTG
TTAAAAAAATACAGCGTTCTTTTGGAAGGATAAAATACACCTCCTCCCATTCAATCATTC
GAAGAAATGAAGTTTCCCAAAAAAATTATTGCAATTTTAAAAGAAAAAAAAGTAAAGAAA
CCTACTCCTATTCAAATGGTTGGACTTCCTACAGTATTGCTTGGTAGGGATATGATAGGA
ATAGCTCCCACTGGACAGGGTAAAACAATAGTTTTTTTACTCCCTGCTTTAGTTATGGCG
ATAGAGCATGAGATGAATATGCCTTTATTTAGGGGTGAAGGTCCATTAGCAATTATAATC
GTTCCATCACATGAACTTGCAATTTAGACCTATGAACTAGCATGTTATTATAGCTAGAAG
CTCCAAGAAGCTGGTTATCCTTAAATTAGATGCTCTTTGAGCATTGGTGGTATGGATATG
ATGTAACAGATTGCATAAGTTAGAGAAGGAGTACATTTGATGGTTGGAACACCTGGTAGA
ACATCAGACATGGTTGATAAACAAAAATTTAATATGAATTTATGCAGATACATTGTTTTG
GACGAAGCTGATAGACTCTTAGACATGATATTCGAAAAGGAAATCAGAAATATAATAGAT
CACGTTCCCGGTGCCAGATAAACTTTACTATTTTCTTCAACAATGCCTAAGAAAGTTTAA
GATTTTGCTAAATAAGCTTTGATTGATCCAATAATAGTTAATGTCGGAAGAGCTGGCTAA
GTTAATTTGAATGTCATTTAAGAAGTTGAGTATGTGAAATAAGAAGAAAAGTTATAATAC
CTTATATCATGTCTTTAAAAAACAAAGCCTCCAGTTTTAATATTTTGCGATAAGTCTAAT
GATGTAGACGATATCCACGAGTATCTGCTTTTAAAAGGAATAGATGTCACTTCTTTACAT
GGAGGAAAAAAATAGGAAGAAAGAACAAAGGCAATGAAGGAGTTTTAATAAAGCTAGAAA
GATGTTCTTGTTGCTACAGATATTGGGGCGAAAGGGTTAGATTTTCCAAACGTTTAGCAT
GTAATTAACTTTGATATGCCAAAAGAAATAGAAAGTTACGTTCATAGAATTGGAAGAACA
GGAAGATTGGGTAAAACTGGAAGAGCGACAACATTTGTAAATAAATAACAAGATGAAAAT
ATATTAAGTGACTTAAAGATGCTTCTAATGGAAGCTAAATAACCTATCCCACACTTCTTG
AAATAAATCACGCATGATAGTTAAACTGGAGGTTGTGGTTTTTGTGGTGGACTAGGTCAT
ACTATTCATAATTGTAATAAGCTTGAGCAATAAAAGATGAAAGCTCTGACAGTGAGTGCT
TAACAGAATTCAAAAGAGGAGCTTAAATAATATTTACCTGATTAGCATCCTTTAAAAGTA
AGCATCCCATTAGTAAAAAAAGATTGA


>TTHERM_00923120(protein)
MQNSNQNVSKVTFDDLKSNQKSLLEKAQELKSKHVEQYVEEEEIEVEDPELDNMNFMTVV
KNTALGGLIERKEQIKERVKTTWRIPKAYRTVTQREIQKVLKKYSVLLEGQNTPPPIQSF
EEMKFPKKIIAILKEKKVKKPTPIQMVGLPTVLLGRDMIGIAPTGQGKTIVFLLPALVMA
IEHEMNMPLFRGEGPLAIIIVPSHELAIQTYELACYYSQKLQEAGYPQIRCSLSIGGMDM
MQQIAQVREGVHLMVGTPGRTSDMVDKQKFNMNLCRYIVLDEADRLLDMIFEKEIRNIID
HVPGARQTLLFSSTMPKKVQDFAKQALIDPIIVNVGRAGQVNLNVIQEVEYVKQEEKLQY
LISCLQKTKPPVLIFCDKSNDVDDIHEYLLLKGIDVTSLHGGKKQEERTKAMKEFQQSQK
DVLVATDIGAKGLDFPNVQHVINFDMPKEIESYVHRIGRTGRLGKTGRATTFVNKQQDEN
ILSDLKMLLMEAKQPIPHFLKQITHDSQTGGCGFCGGLGHTIHNCNKLEQQKMKALTVSA
QQNSKEELKQYLPDQHPLKVSIPLVKKD


>TTHERM_00923120(gene)
ATGTAGAATTCAAATTAAAATGTATCGAAAGTCACTTTCGATGATTTAAAATCAAATTAA
AAGTCTCTCCTTGAAAAGGCGCAGGAATTGAAGTCAAAACATGTAGAGCAATATGTAGAA
GGTATGTGATTAACAAATTATAGTAGATATTAATACTTTTAGTTAATGATTTAGAGAGAA
TCTTCATATATTTTTAATCTAAACAGAGGAAGAAATAGAAGTTGAAGACCCAGAACTAGA
TAATATGAACTTTATGACAGTAGTTAAAAATACTGCTTTAGGAGGACTGATTGAAAGGAA
GGAATAAATTAAAGAAAGGGTGAAAACTACGTAAAAATCATAAATTAAATTAATTAGCCA
TTTTAAAGAAGCTTGAATTAAATTAGATGGAGAATACCCAAGGCTTATAGGACAGTTACT
TAGAGGGAGATTTAAAAAGTGTTAAAAAAATACAGCGTTCTTTTGGAAGGATAAAATACA
CCTCCTCCCATTCAATCATTCGAAGTAAATCTATTGATAGCTTAATTTAGTCATTAATAT
TCCCTAATTGTTTTAAAGGAAATGAAGTTTCCCAAAAAAATTATTGCAATTTTAAAAGAA
AAAAAAGTAAAGAAACCTACTCCTATTCAAATGGTTGGACTTCCTACAGTGTACCTTATT
TATTGTAATTTTGGCTTAATTTAAAAAAAAATTATATTATAAAGATTGCTTGGTAGGGAT
ATGATAGGAATAGCTCCCACTGGACAGGGTAAAACAATAGTTTTTTTACTCCCTGCTTTA
GTTATGGCGATAGAGCATGAGATGAATATGCCTTTATTTAGGGGTGAAGGTCCATTAGCA
ATTATAATCGTTCCATCAGTAAGTTAATTTAAGAGTGTTAATATTAAAAATAAGAAATAA
AAAATTAAAAGCATGAACTTGCAATTTAGACCTATGAACTAGCATGTTATTATAGCTAGA
AGCTCCAAGAAGCTGGTTATCCTTAAATTAGATGCTCTTTGAGCATTGGTGGTATGGATA
TGATGTAACAGATTGCATAAGTTAGAGAAGGAGTACATTTGGTAATTAAAATATACTTCT
TTAAATTTTTATTCTTATAGTAAGATAAAATATTACGGATTAATGAACAATACTTTCGAA
ATTTATGAGGTGGTTGAATTATAGTTAGATGTATGTAATTTTTAATAAATTCAAGCACGG
AAAAATTGAAAAATGTATTTGAGAATACAGTTTTTACTTTATTAATTACCAGAATTATAA
CTTTTTTATTTTTGAATAGATGGTTGGAACACCTGGTAGAACATCAGACATGGTTGATAA
ACAAAAATTTAATATGAATTTATGCAGATACATTGTTTTGGACGAAGCTGATAGACTCTT
AGACATGATATTCGAAAAGGAAATCAGAAATATAATAGATCACGTTCCCGTATTTAATTT
AAATAGTTTAGATTATTTAAAAAATTAAAATTAAATCAATAAATCATTAAATAGACAAAT
AAAGCTTTTTAAATTTTTATTACAAATCATAATCGTAATTTAAAATATTTAATGTAACCT
TTTGTAAGGTAAATAGGGTGCCAGATAAACTTTACTATTTTCTTCAACAATGCCTAAGAA
AGTTTAAGATTTTGCTAAATAAGCTTTGATTGATCCAATAATAGTTAATGTCGGAAGAGC
TGGCTAAGTTAATTTGAATGTCATTTAAGAAGTTGAGTATGTGAAATAAGAAGAAAAGTT
ATAATACCTTATATCATGTCTTTAAAAAACAAAGCCTCCAGTTTTAATATTTTGCGATAA
GTCTAATGATGTAGACGATATCCACGAGTATCTGCTTTTAAAAGGAATAGATGTCACTTC
TTTACATGGAGGAAAAAGTAAAGATTTAAAACCTGAATAAAAAAAAGAGTTTAATTTGTT
ATTTTAAATAGAATAGGAAGAAAGAACAAAGGCAATGAAGGAGTTTTAATAAAGCTAGAA
AGATGTTCTTGTTGCTACAGATATTGGGGCGAAAGGGTTAGATTTTCCAAACGTTTAGCA
TGTAATTAACTTTGATATGCCAAAAGAAGTAATTTTATTAAAAGTGATAAAGAAGTAAAT
TTTGTAATTCAACATTTAAATTTAATAGATAGAAAGTTACGTTCATAGAATTGGAAGAAC
AGGAAGATTGGGTAAAACTGGAAGAGCGACAACATTTGTAAATAAATAACAAGATGAAAA
TATATTAAGTGACTTAAAGATGCTTCTAATGGAAGCTAAATAACCTATCCCACACTTCTT
GAAATAAATCACGCATGATAGTTAAACTGGAGGTTGTGGTTTTTGTGGTGGACTAGGTCA
TACTATTCATAATTGTAATAAGCTTGAGCAATAAAAGATGAAAGCTCTGACAGTGAGTGC
TTAACAGAATTCAAAAGAGGAGCTTAAATAATATTTACCTGATTAGCATCCTTTAAAAGT
AAGCATCCCATTAGTAAAAAAAGATTGA