Identifiers and Description

Gene Model Identifier

TTHERM_00469380

Standard Name

DRH14 (DExD/H box RNA helicase 14)

Aliases

PreTt18740 | 55.m00295 | 3710.m00143

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family
  • ( TIGR00269 ) conserved hypothetical protein TIGR00269

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00469380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15654.19.997093137033517e-262DEAD/DEAH box helicase (412 aa
)
OxytrichaContig10970.0.g317.996964956232603e-130DEAD/DEAH box helicase
SGDYDL084W5.00227046936594e-128SUB2 Component of the TREX com
plex required for nuclear mRNA
export; member of the DEAD-bo
x RNA helicase superfamily and
is involved in early and late
steps of spliceosome assembly
; homolog of the human splicin
g factor hUAP56
DictyBaseDDB_G02699322.000808864924972e-124uap56 on chromosome: 1 positio
n 3893359 to 3895841
WormBaseWBGene000018406.99920276797163e-121locus:hel-1 Spliceosome RNA
helicase DDX39B homolog stat
us:Confirmed UniProt:Q18212
protein_id:CAA91120.1
Stentor CoeruleusSteCoe_293304.7111658015535965e-58

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00469380(coding)
ATGAGCAACCAAGAAGAAGAAGTCCCTATCTACGATCCCGATGATGAAATTGAAGCTAAC
TCAACTGCTCCTGTTTAGAAGCATGCCTAAGGTTTCAACACTGGCGGTCACTCCTCATTT
AATGACTTTTCATTGAAGTAAGATTTACTTAGAAGTGTCAAAGAAGCTGGTTTTGAAAGA
CCATCTGAAGTTCAACACTAATGTATCCCCAATGCAATCCATGGTAAAGACGTCTTGTGC
CAAGCTAAGGCCGGTACTGGAAAGACTGCTGTGTTTGTCTTGTCAGTGCTCAATCAATTA
CCCGACGATGCTAAGCCTTTCAGTTGTTTAGTTTTGTGCCACACTAGAGAATTAGCTTTC
CAAATTAAGAACGAATTCAAGCGTCTTGGTAAATTCACCAACTTCAAGGTTAAGGCTGTT
TATGGAGGTGTTGAAGAATCTGTTGACATCCATACCCTCAAAACTAAGAAGCCCCATATC
CTCGTTGCTACTCCTGGTCGTTGCCTTTCTTTAATCAAGGCTAAGCCTTCTGTTATTGAA
ACTCAAAATATAGAATATTTCATTATCGATGAATGCGATCGTGTTTTGAGCAGCAACAAA
ATGAGATCTGATGTTCAAAATATCTTCTACGAACTTCCTAGAAAGAAATAAGTTATGATG
TTTAGTGGTACCATGTCAGATGAAAGTAAAAAAACCTGCCGTAAATTCTTGCAAGATTAA
ATTGAAATCTTCGTTGAAGATAATTCAAAGCTTGTTTTGCACGGTTTGGAATAATATCAC
ATTAAAATTGAAGAAAAGTAGAAAATCTCAGTTTTGCGTTAACTCCTTGATTAAGGTAAC
TACAACCAAGTTATTATTTTTGTCAACAAGTAAGACAGAGCTAAATATCTTTCAAAGTAT
CTCACCGATAAAGGCCACGACAATGCCTTCATTTATCGTAACCTCGACTAAAGCGAACGT
ACAAAAATATACTCTGAATTCAAAGAAGGCAAGAATAGAGTTTTAGTTGCTACTGACTTA
GTCGGAAGAGGTATTGATATTGAAAGAGTCAACCTCGTTATCAACTTTGATATGCCATAA
ATTACTGAAGACTACATGCACAGAGTCGGTAGAGCTGGTCGTTTCGAGACCAAAGGTTAA
GCTATTTCTTTCATCTCAACTAAGGAAGATGAAAAAGTACTTGCTGAAATTCAAAGTACT
TTCAGCACTCAAATTAAGGAGTACAACTTAAAGCAAGAATCTTAGTAATAAATATATTTA
ATATTAATTATGGATAAATATTAAAATAATTCTTTTTAATTTTTAGGTGAAAGAAATTAG
TAAGACCTCAACTCTAAAAATGTTTAACCCCAAATAAAATTTGGATAAATAAATTATAAT
TATTATTAAAGATTGTCAATTAATATATATTATTCACTTTGTAACTCATTCCTTAATTCG
AGTCAACTTTAAGTAAATGTATACTTTCAAAAAAGACTATTTAGTTTCCTAAAAAACAAG
TAAATAAATAAATAAAAATCAATAATACCATCAGTATTTATTTAGTTATTTTATAATAAA
TATATTTTTATTAAGAACCATTTTCTGCCTCACAAGCAAACAAACGATTCTAGCAATCAG
AAAAATTAAAACAGAATTAAGAGAAGAAATTCTACCTATTTTAGTTAGGAATTTACTAAC
ATTCAAAATTTCATTTATTGA


>TTHERM_00469380(protein)
MSNQEEEVPIYDPDDEIEANSTAPVQKHAQGFNTGGHSSFNDFSLKQDLLRSVKEAGFER
PSEVQHQCIPNAIHGKDVLCQAKAGTGKTAVFVLSVLNQLPDDAKPFSCLVLCHTRELAF
QIKNEFKRLGKFTNFKVKAVYGGVEESVDIHTLKTKKPHILVATPGRCLSLIKAKPSVIE
TQNIEYFIIDECDRVLSSNKMRSDVQNIFYELPRKKQVMMFSGTMSDESKKTCRKFLQDQ
IEIFVEDNSKLVLHGLEQYHIKIEEKQKISVLRQLLDQGNYNQVIIFVNKQDRAKYLSKY
LTDKGHDNAFIYRNLDQSERTKIYSEFKEGKNRVLVATDLVGRGIDIERVNLVINFDMPQ
ITEDYMHRVGRAGRFETKGQAISFISTKEDEKVLAEIQSTFSTQIKEYNLKQESQQQIYL
ILIMDKYQNNSFQFLGERNQQDLNSKNVQPQIKFGQINYNYYQRLSINIYYSLCNSFLNS
SQLQVNVYFQKRLFSFLKNKQINKQKSIIPSVFIQLFYNKYIFIKNHFLPHKQTNDSSNQ
KNQNRIKRRNSTYFSQEFTNIQNFIY


>TTHERM_00469380(gene)
ATGAGCAACCAAGAAGAAGAAGTCCCTATCTACGATCCCGATGATGAAATTGAAGCTAAC
TCAACTGCTCCTGTTTAGAAGCATGCCTAAGGTTTCAAGTAATTAACTATTATAAGAAAA
TAATACTTTTATCAACAAATTATTGCATTTTACTTATATATTATATTTTTAAATAATTAT
TGTCTATTTAAAAATATAGCACTGGCGGTCACTCCTCATTTAATGACTTTTCATTGAAGT
AAGATTTACTTAGAAGTGTCAAAGAAGCTGGTTTTGAAAGACCATCTGAAGGTAATAAAG
ACTTTTATTTAGTTGCATTTATTAACATTTGATTGCAATCATATATTTTTTTCGAATGCT
GGCAAAATCTGTTTGATTGGTCGAACTCTTTTACTCATTAATTATATGAAAATGTAATCA
ATAAAAGAATAAATCTTAAAATATTTTTATATAAAAAAATAGTTCAACACTAATGTATCC
CCAATGCGTAAGACTACTTCAACTTTACTTAAAACTACTAAAAATATAATGGCAAACTCA
AAACCTTGCCATTATACTTCTTTTCTTCCGACATCCTCCCCTGAGTCGTTGTATAATATA
TTGCGCAAACAAATATATTATGGTTACTGACGAAGAAGAAGGAATCGCGAGAGAGAGATT
AGATATAATAAGAAAATGTGTGAGAGAGAAAGAGAGAAGAAGATTATGTTATATAAAAGA
CGATAGATTAGAATTATAGTCTCTTAGCTAGAGCTTAAAATATTTATTAGTTACTTTACT
ATTGATATAAATCCACAAAAACATAAATACATAAATACATACATAAATAAATAAAATAAA
TACATACAATCGGTCTTTAAAAGCTTATTGTTATAAAATAAATAAATAAATGGATTTAAT
GGTTTTTACTACAAAATAGTATAAATAACCTCATCATTTTAGAGACTAAAAATTATTAAA
TTTAATGTTCATTATAACATCATCCGTCCTCTTCTAACTCAACCACTTAATTATCAAAAA
TCTACTTAAAAACTTACCTTAACCCTCCTTGAAAATACATGTAAAAAACTCTGATTGTAT
ATAAAAAATAGAATCCATGGTAAAGACGTCTTGTGCCAAGCTAAGGCCGGTACTGGAAAG
ACTGCTGTGTTTGTCTTGTCAGTGCTCAATCAATTACCCGACGATGCTAAGCCTTTCAGT
TGTTTAGTTTTGTGCCACACTAGAGAATTAGCTTTCCAAATTAAGAACGAATTCAAGCGT
CTTGGTAAATTCACCAACTTCAAGGTTAAGGCTGTTTATGGAGGTGTTGAAGAATCTGTT
GACATCCATACCCTCAAAACTAAGAAGCCCCATATCCTCGTTGCTACTCCTGGTCGTTGC
CTTTCTTTAATCAAGGCTAAGCCTTCTGTTATTGAAACTCAAAATATAGAATATTTCATT
ATCGATGAATGCGATCGTGTTTTGAGCAGCAACAAAATGAGGTAAAATCAGAATAAAATT
TATCAATAACCATTCTATTTGCTTTATATCTCGATTAAAAATTTAAAAATTTAACTGGAT
CAAGCTTGTATTGAAAATCCTTTACTTAAAATAATAAATAAAGATCTGATGTTCAAAATA
TCTTCTACGAACTTCCTAGAAAGAAATAAGTTATGATGTTTAGTGGTACCATGTCAGATG
AAAGTAAAAAAACCTGCCGTAAATTCTTGCAAGATGTAATTAATAAATACGAATTATATA
TAATAGGACTCTTCTTTACTATTTATTTATTCTTAATTTTTCCTACTTTTTGCCTCCTTC
TTCTAACTTTTAAACATCAAAAAAAAAACAAATAAAAATTTTCCCCAAGCTTTTTCTTTC
TAAATTTAATTATTTGCATTAATTAATCTATCATGATTAATCAAAAAATATTTAAAAACT
AATTGATTAAGTGAAATAATAATAATAAACAAACAAAAATTAACAAAAGTAAATTGAAAT
CTTCGTTGAAGATAATTCAAAGCTTGTTTTGCACGGTTTGGAATAATATCACATTAAAAT
TGAAGAAAAGTAGAAAATCTCAGTTTTGCGTTAACTCCTTGATTAAGGTAACTACAACCA
AGTTATTATTTTTGTCAACAAGTAAGACAGAGCTAAATATCTTTCAAAGTATCTCACCGA
TAAAGGCCACGACAATGCCTTCATTTATCGTAACCTCGACTAAAGCGAACGGTAAATATA
TATATTTCTTTATGCTTATTAACTAAGTTTTCTTTAGCTTTATTCTAAACAAAACTTTTC
TAATTATAGTACAAAAATATACTCTGAATTCAAAGAAGGCAAGAATAGAGTTTTAGTTGC
TACTGACTTAGTCGGAAGAGGTATTGATATTGAAAGAGTCAACCTCGTTATCAACTTTGA
TATGCCATAAATTACTGAAGACTACATGCACAGAGTCGGTAGAGCTGGTCGTTTCGAGAC
CAAAGGTTAAGCTATTTCTTTCATCTCAACTAAGGAAGATGAAAAAGTACTTGCTGAAAT
TCAAAGTACTTTCAGCACTCAAATTAAGGAGTACAACTTAAAGCAAGAATCTTAGTAATA
AATATATTTAATATTAATTATGGATAAATATTAAAATAATTCTTTTTAATTTTTAGGTGA
AAGAAATTAGTAAGACCTCAACTCTAAAAATGTTTAACCCCAAATAAAATTTGGATAAAT
AAATTATAATTATTATTAAAGATTGTCAATTAATATATATTATTCACTTTGTAACTCATT
CCTTAATTCGAGTCAACTTTAAGTAAATGTATACTTTCAAAAAAGACTATTTAGTTTCCT
AAAAAACAAGTAAATAAATAAATAAAAATCAATAATACCATCAGTATTTATTTAGTTATT
TTATAATAAATATATTTTTATTAAGAACCATTTTCTGCCTCACAAGCAAACAAACGATTC
TAGCAATCAGAAAAATTAAAACAGAATTAAGAGAAGAAATTCTACCTATTTTAGTTAGGA
ATTTACTAACATTCAAAATTTCATTTATTGA