Identifiers and Description

Gene Model Identifier

TTHERM_00683160

Standard Name

DRH13 (DExD/H box RNA helicase 13)

Aliases

PreTt16153 | 103.m00144 | 3734.m00056

Description

DExD/H box RNA helicase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( TIGR01805 ) chorismate mutase
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF02181 ) Formin Homology 2 Domain
  • ( PF04428 ) Choline kinase N terminus
  • ( PF00176 ) SNF2 family N-terminal domain
  • ( PF07465 ) Photosystem I protein M (PsaM)
  • ( TIGR01389 ) ATP-dependent DNA helicase RecQ
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF08011 ) Protein of unknown function (DUF1703)
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family
  • ( TIGR03053 ) photosystem I reaction center subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00683160

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17805.19.997093137033517e-262type III restriction enzyme, r
es subunit protein (643 aa)
OxytrichaContig803.1.g979.997540506729281e-98DEAD/DEAH box helicase
SGDYOR204W1.999534248571833e-46DED1 ATP-dependent DEAD (Asp-G
lu-Ala-Asp)-box RNA helicase,
required for translation initi
ation of all yeast mRNAs; muta
tions in human DEAD-box DBY ar
e a frequent cause of male inf
ertility
WormBaseWBGene000022449.997441244797434e-45locus:laf-1 status:Confirmed
UniProt:Q4W5R4 protein_id
:CCD73871.1
DictyBaseDDB_G02836617.00174216458014e-43ddx3 on chromosome: 4 position
939305 to 941576
Stentor CoeruleusSteCoe_107472.2273635617957438e-39

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00683160(coding)
ATGGTAAGCAAAATTAGTTAATAGAATTACTATTAATATAGAGATAACAATCACTTTAGA
AGAATCTTGAATTAATTTAATATTTTGTTACTTTTTCTTCTACTCGCAAATATTAAAGTA
TTCCCTATTTTAAGTACAGCATTAAAGCCTTCATTTGGCTTAGCCAATAGATTGCCTTTT
GATTTAGCAAAATGCAAGATTAACCCTTATATTTTAGGATTTAGTTTGACATATAGATAG
CAATTTGGATTTGCAAATGTAGCACTTCCCTCATTCAATTACAATATTCATGAAAAAATA
AAAAAGGCACTTGAATCTCAAAATATTTTCACACCATCACCTATATAAGATTTAGCAATA
CCAGCTTTACTCAACCAAAATCATAATAATTTCTTCTTGGCTGCATAAACTGGTACTGGA
AAGACCTTAGCTTATCTCATTCCTATTATTTCATAATTTAAAAAGCTTGAAGAAGCCAAT
CATAATTAAAGATTAACAACCCCTAATAGACCAAGTATAATAATTATAGTGCCCACAAAA
GAATTAGCCAATTAGTTAGAAGACGAATGCAAAAAATTAATCCATTTTGCTAAATTTACT
TGTCTAGGAGTAAATAATTCAAAAGTATTTATGAGAGAGAAAAAAGCACTTGATGAAGGA
GTAGATGTGTTGATAGGTACTCCCGATAGAATTGAGCGTCATAGAGAAAAAGGAAACTTA
TTCTTAAGCAATGTTTCTTACTTCGTTGTTGATGAAGCAGATACTTTCTTAGATTCTGGA
TATAAGGAAGTAATTGAAACTTACATAAAGACAATAACTCATAGGCAAGAATAAATAAAA
GAGGGTAATTATAGCAAAAATATTCCAAAAATGATCTTCGTAAGTGCAACTTATACTGGA
TAATTAAGATTACTCTTCGAATCATCCTTTGATAATTTCAAAAAAATAAAACTAATTATT
GATAAAAAGACTCATATGAATTTGTAGCATATTGAGCATGAATTTATTCATTGTCAAGGC
ATAGATAAAAAAGAACCTATCACTAAATTATTAAAAGAAATTATGCCAAAGGCTTAAAAG
CAAGATGGCAGTATAATGATATTTTGTAATAGTATTCCTTCATGCAGATCATTAGATTAT
ACTTTATCTGAGGAAGGATATGATGTAGTTAGTTTCCATGGTGATATTCCTAAGAGATTA
AGAATACAAAATTTTGATAGATTTAAGTCAAGAGAATCAAAAATTATGATTTGCACTGAC
TTAGCTTCTAGAGGTCTTGACTTCCCTTTTCTAACTCATGTTGTTAATTATGATTTCCCA
ATAACAACTTCTGACTATTTGCATAGAGCAGGAAGAACTGGCAGAGCAGGACGTAAGGGA
AGTGTGATCAGTTTATATCATAATAAAGATAATAATATTATAAATGAACTCAAGAAGTCT
CATGATAATAAAATTCCAGTGAATATTAAGGGTTCTTAATACGCAACAATTAATAAAGAA
GTGCTTCAGAGATTAAAATAAAAATCAGAAGAAAGTAGTGAATTAAATAAATATGAATAG
TTGAAATAGAAGTTGATTGAAGACTCTAAAAAAGCTTAGCTAATTCCTTATGTTCCCAAA
TCGTATATAGAATTTAAGAGTAATTATGAGAATGGTAAACTTATTACAGCAGCTAAAAAG
GGCAACTCTGATTTAAAGAAATAATTGAAAAATTATATCCCAGAAATAAATAGAGATAAA
GAGTAGCTTAAAGAGTTAGAATCATAAGTAAAGGGAGTTAAAAAGAAATATAAATTGCTT
AATTAAAATAGATTTAAAGATCTTAAAGGGCGTATTCGCGCTCTAAAGAGAAACATACAA
GTTAAGTAATTAAAAGAAAAAGGTTAACTACATGTCCTAAGAAAACATAAATTAATAGAA
TCAAATTTAAAGAGATAAACCAGAGTTAGAAAGCAAAAGGCTAGAGAGCAATATGCTCCT
AAAAAATGA


>TTHERM_00683160(protein)
MVSKISQQNYYQYRDNNHFRRILNQFNILLLFLLLANIKVFPILSTALKPSFGLANRLPF
DLAKCKINPYILGFSLTYRQQFGFANVALPSFNYNIHEKIKKALESQNIFTPSPIQDLAI
PALLNQNHNNFFLAAQTGTGKTLAYLIPIISQFKKLEEANHNQRLTTPNRPSIIIIVPTK
ELANQLEDECKKLIHFAKFTCLGVNNSKVFMREKKALDEGVDVLIGTPDRIERHREKGNL
FLSNVSYFVVDEADTFLDSGYKEVIETYIKTITHRQEQIKEGNYSKNIPKMIFVSATYTG
QLRLLFESSFDNFKKIKLIIDKKTHMNLQHIEHEFIHCQGIDKKEPITKLLKEIMPKAQK
QDGSIMIFCNSIPSCRSLDYTLSEEGYDVVSFHGDIPKRLRIQNFDRFKSRESKIMICTD
LASRGLDFPFLTHVVNYDFPITTSDYLHRAGRTGRAGRKGSVISLYHNKDNNIINELKKS
HDNKIPVNIKGSQYATINKEVLQRLKQKSEESSELNKYEQLKQKLIEDSKKAQLIPYVPK
SYIEFKSNYENGKLITAAKKGNSDLKKQLKNYIPEINRDKEQLKELESQVKGVKKKYKLL
NQNRFKDLKGRIRALKRNIQVKQLKEKGQLHVLRKHKLIESNLKRQTRVRKQKAREQYAP
KK


>TTHERM_00683160(gene)
ATGGTAAGCAAAATTAGTTAATAGAATTACTATTAATATAGAGATAACAATCACTTTAGA
AGAATCTTGAATTAATTTAATATTTTGTTACTTTTTCTTCTACTCGCAAATATTAAAGTA
AAAAATATACAAGTTAAAGTAAATGCTTAAGTTGTTCTAAAAATAATAGGTATTCCCTAT
TTTAAGTACAGCATTAAAGCCTTCATTTGGCTTAGCCAATAGATTGCCTTTTGATTTAGC
AAAATGCAAGATTAACCCTTATATTTTAGGATTTAGTTTGACATATAGATAGCAATTTGG
ATTTGCAAATGTAGCACTTCCCTCATTCAATTACAATATTCATGAAAAAATAAAAAAGGC
ACTTGAATCTCAAAATATTTTCACACCATCACCTATATAAGATTTAGCAATACCAGCTTT
ACTCAACCAAAATCATAATAATTTCTTCTTGGCTGCATAAACTGGTACTGGAAAGACCTT
AGCTTATCTCATTCCTATTATTTCATAATTTAAAAAGCTTGAAGAAGCCAATCATAATTA
AAGATTAACAACCCCTAATAGACCAAGTATAATAATTATAGTGCCCACAAAAGAATTAGC
CAATTAGTTAGAAGACGAATGCAAAAAATTAATCCATTTTGCTAAATTTACTTGTCTAGG
AGTAAATAATTCAAAAGTATTTATGAGAGAGAAAAAAGCACTTGATGAAGGAGTAGATGT
GTTGATAGGTACTCCCGATAGAATTGAGCGTCATAGAGAAAAAGGAAACTTATTCTTAAG
CAATGTTTCTTACTTCGTTGTTGATGAAGCAGATACTTTCTTAGATTCTGGATATAAGGA
AGTAATTGAAACTTACATAAAGACAATAACTCATAGGCAAGAATAAGTAAAAAATATTAA
TCAATTAATTTGTCTATTCAATAATTTGATATTTTAACATAATTTTGAAAAAATAATTTA
TTAAACACTCTCTAAAACAATAATTCTTGATTTTAAGCAAGGCTTAAAAAAGATGTTATT
GAAAAATATTTATTTTTGAGGAATTTTAAATTTTAGCTTTCAAATAATAAGAAAATGTTA
ATTATTATTTTTATTTTTAAATAGATAAAAGAGGGTAATTATAGCAAAAATATTCCAAAA
ATGATCTTCGTAAGTGCAACTTATACTGGATAATTAAGATTACTCTTCGAATCATCCTTT
GATAATTTCAAAAAAATAAAACTAATTATTGATAAAAAGACTCATATGAATTTGTAGCAT
ATTGAGCATGAATTTATTCATTGTCAAGGCATAGATAAAAAAGAACCTATCACTAAATTA
TTAAAAGAAATTATGCCAAAGGCTTAAAAGCAAGATGGCAGTATAATGATATTTTGTAAT
AGTATTCCTTCATGCAGATCATTAGATTATACTTTATCTGAGGAAGGATATGATGTAGTT
AGTTTCCATGGTGATATTCCTAAGAGATTAAGAATACAAAATTTTGATAGATTTAAGTCA
AGAGAATCAAAAATTATGATTTGCACTGACTTAGCTTCTAGAGGTCTTGACTTCCCTTTT
CTAACTCATGTTGTTAATTATGATTTCCCAATAACAACTTCTGACTATTTGCATAGGTAT
AAAATTTTTAAAATATTTTCTTTTATAAATGTGATATCTTCTTTCATATTTTTATATTTT
TCTAAGCAAATACATTGTTTTTAGATCATTTAAATTTAAGGATGAAATTTATTTTATTTT
TTTATTAACTAATTTATAAATTTATTTAGAGCAGGAAGAACTGGCAGAGCAGGACGTAAG
GGAAGTGTGATCAGTTTATATCATAATAAAGATAATAATATTATAAATGAACTCAAGAAG
TCTCATGATAATAAAATTCCAGTGAATATTAAGGGTTCTTAATACGCGTATGACTGACTT
AGACTAAATTTTATAATTTTAAACATATGTTTTTATAAAAATAGAACAATTAATAAAGAA
GTGCTTCAGAGATTAAAATAAAAATCAGAAGAAAGTAGTGAATTAAATAAATATGAATAG
TTGAAATAGAAGTTGATTGAAGACTCTAAAAAAGCTTAGCTAATTCCTTATGTTCCCAAA
TCGTATATAGAATTTAAGAGTAATTATGAGAATGGTAAACTTATTACAGCAGCTAAAAAG
GGCAACTCTGATTTAAAGAAATAATTGAAAAATTATATCCCAGAAATAAATAGAGATAAA
GAGTAGCTTAAAGAGTTAGAATCATAAGTAAAGGGAGTTAAAAAGAAATATAAATTGCTT
AATTAAAATAGATTTAAAGATCTTAAAGGGCGTATTCGCGCTCTAAAGAGAAACATACAA
GTTAAGTAATTAAAAGAAAAAGGTTAACTACATGTCCTAAGAAAACATAAATTAATAGAA
TCAAATTTAAAGAGATAAACCAGAGTTAGAAAGCAAAAGGCTAGAGAGCAATATGCTCCT
AAAAAATGA