Identifiers and Description

Gene Model Identifier

TTHERM_00220750

Standard Name

DRH12 (DExD/H box RNA helicase 12)

Aliases

PreTt22403 | 18.m00429 | 3701.m00186

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF07609 ) conserved hypothetical protein
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00220750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_250340
WormBaseWBGene000220299.997093137033517e-262status:Partially_confirmed U
niProt:Q9BL61 protein_id:CCD
71923.1
Tetrahymena borealisEI9_06761.19.997093137033517e-262DEAD/DEAH box helicase (397 aa
)
DictyBaseDDB_G02691929.997093137033517e-262tifA on chromosome: 1 position
3537960 to 3539386
OxytrichaContig2735.0.g1219.997093137033517e-262DEAD/DEAH box helicase
SGDYDR021W2.0009778678102968e-172FAL1 Nucleolar protein require
d for maturation of 18S rRNA,
member of the eIF4A subfamily
of DEAD-box ATP-dependent RNA
helicases

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00220750(coding)
ATGGACTCATCTAAACTTAAAGAATAGAATTAATAATATGAATCTAATGAAGATATCGAA
GTTATCACTTAATTCGAAAAGATGGGCTTGAAAGAAGAGCTCCTTAGAGGTATCTTAACT
TATGGTTTTGACAAACCATCAGCTGTTCAACAAAGAGCTATTAAGCCTATAATTAAAGGT
CGTGATGTCATAGTTCAAAGTCAAGCAGGTACTGGTAAAACTGGTGTCTTTACTATTGCA
GCTCTTCAAATAGTCGACAAAAACCTCCGTGAACCTTAAGTAATTGTTTTATCTCCTACT
CGTGAACTTGCTGAGTAAACTCAAAAGGTTTGTTTAGCTCTTGGTGACTACATGAACATT
TTAGTTCACTGTTGTATTGGTGGTAAGAGCATGGATGATGATATTAATAGATTAGAAAAA
GGTGTTTAAATTATTTCAGGTACTCCTGGTCGTATTTATGATATGATTTAGCGCAGACAC
TTGAAAACTCGTAACGTTAAGATGCTTGTTTTGGACGAAGCTGATCAGATGCTTTCTATG
GGTTTCAAAGAATAGGTTTATGATATTTATAGATATCTTCCCCACAAAAATCAAAATGTA
GTTGTCAGTGCAACCTTACCTCAAGAAATTTTGGAAATGACTAATAAATTTATGAATGAT
CCTATCAAATTCTTAGTCAAGAGAGATGAGCTTACACTTGAAGGTATTAAATAGTTTTTC
ATTTTAGTTGAAAAAGAAGAATGGAAGTTTGAAACATTATGTGATTTATACAATACTATC
ACAATCACTCAAGCAGTTATATTTTGTAATACCATCAAGGCTGTAAAATGGCTTTCTGGT
AAAATGAGAGAACAAAACTTCTCTCTTTGTTCCATTCATGGTGAGTTAAATCAAAAGGAA
AGAGATAAAATTATGCAAGATTTCCGTAACGGAGAGTATCGTGTTCTTGTTGCCACAGAT
ATCTGGGGTAGAGGTCTTGATGTTTAATAAGTTTCTGTTGTTATCAATTACGATCTTCCT
ACTAATCGTGAACTTTACATCCATAGAATCGGTCGTTCAGGCCGTTTTGGAAGAAAAGGT
GTTGCAATCAATTTTGTTAAAAATGAAGATGTTAGTGCCTTGAGAGATATTGAATAGTAT
TACTCTACTTAAATTGATGAAATGCCTTACAATGTTAGTGAATTGATTTGA


>TTHERM_00220750(protein)
MDSSKLKEQNQQYESNEDIEVITQFEKMGLKEELLRGILTYGFDKPSAVQQRAIKPIIKG
RDVIVQSQAGTGKTGVFTIAALQIVDKNLREPQVIVLSPTRELAEQTQKVCLALGDYMNI
LVHCCIGGKSMDDDINRLEKGVQIISGTPGRIYDMIQRRHLKTRNVKMLVLDEADQMLSM
GFKEQVYDIYRYLPHKNQNVVVSATLPQEILEMTNKFMNDPIKFLVKRDELTLEGIKQFF
ILVEKEEWKFETLCDLYNTITITQAVIFCNTIKAVKWLSGKMREQNFSLCSIHGELNQKE
RDKIMQDFRNGEYRVLVATDIWGRGLDVQQVSVVINYDLPTNRELYIHRIGRSGRFGRKG
VAINFVKNEDVSALRDIEQYYSTQIDEMPYNVSELI


>TTHERM_00220750(gene)
ATGGACTCATCTAAACTTAAAGAATAGAATTAATAATATGAATCTAATGAAGATATCGAA
GTTATCACTTAATTCGAAAAGATGGGCTTGAAAGAAGAGCTCCTTAGAGGTATCTTAACT
TATGGTTTTGACAAACCATCAGCTGTTCAACAAAGAGCTATTAAGCCTATAATTAAAGGT
CGTGATGTCATAGTTCAAAGTCAAGCAGGTACTGGTAAAACTGGTGTCTTTACTATTGCA
GCTCTTCAAATAGTCGACAAAAACCTCCGTGAACCTTAAGTAATTGTTTTATCTCCTACT
CGTGAACTTGCTGAGTAAACTCAAAAGGTTTGTTTAGCTCTTGGTGACTACATGAACATT
TTAGGTAATTCATTAATAATTTAACTTTCTAAAAGCATTTATTTACTAATCAACATTCCC
TTTTTCAAAAAATAATTTCCATCTACATTAACAAAGTAAATAAAAAAGTTAAAAAGATAT
AATTTTTAAGATTTTCAAGTAAATTCAGCTGATTTTAAACATTATATTTGTATACAATCT
CCAAATATCATTATAAAATATCTATTGGAGTAGTTATCAACAATAAACTAACAAATCAAC
CATGAATATAAATGAAATTTCTAAAAATTTGAACTCTATTATTCAAAAAAATGCAGCTGT
TTTTGAAATTAAATTAAAATCATTTCTGATGATAATTTTTGGTTTAAATAATTTAAAATA
TATAAAAAATAAAAATTAGCTAGAAACAATTATTATAAATTAAAAACTTTAATCAAATTG
AATATTTATAATAATTTAAAATTATTAATTTAGTTCACTGTTGTATTGGTGGTAAGAGCA
TGGATGATGATATTAATAGATTAGAAAAAGGTGTTTAAATTATTTCAGGTACTCCTGGTC
GTATTTATGATATGATTTAGCGCAGACACTTGAAAACTCGTAACGTTAAGATGCTTGTTT
TGGACGAAGCTGATCAGATGCTTTCTATGGGTTTCAAAGAATAGGTTTATGATATTTATA
GATATCTTCCCCACAAAAATCAAAATGTAGTTGTCAGTGCAACCTTACCTCAAGAAATTT
TGGAAATGACTAATAAATTTATGAATGATCCTATCAAATTCTTAGTCAAGAGAGATGAGC
TTACACTTGAAGGTATTAAATAGTTTTTCATTTTAGTTGAAAAAGAAGAATGGAAGTTTG
AAACATTATGTGATTTATACAATACTATCACAATCACTCAAGCAGTTATATTTTGTAATA
CCATCAAGGCTGTAAAATGGCTTTCTGGTAAAATGAGAGAACAAAACTTCTCTCTTTGTT
CCATTCATGGTGAGTTAAATCAAAAGGAAAGAGATAAAATTATGCAAGATTTCCGTAACG
GAGAGTATCGTGTTCTTGTTGCCACAGATATCTGGGGTAGAGGTCTTGATGTTTAATAAG
TTTCTGTTGTTATCAATTACGATCTTCCTACTAATCGTGAACTTTACATCCATAGAATCG
GTCGTTCAGGCCGTTTTGGAAGAAAAGGTGTTGCAATCAATTTTGTTAAAAATGAAGATG
TTAGTGCCTTGAGAGATATTGAATAGTATTACTCTACTTAAATTGATGAAATGCCTTACA
ATGTTAGTGAATTGATTTGA