Identifiers and Description

Gene Model Identifier

TTHERM_00105060

Standard Name

DRH11 (DExD/H box RNA helicase)

Aliases

PreTt23008 | 7.m00457

Description

DEAD/DEAH box helicase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF08152 ) GUCT (NUC152) domain
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01389 ) ATP-dependent DNA helicase RecQ
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00105060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00351.19.997093137033517e-262DEAD/DEAH box helicase (727 aa
)
OxytrichaContig9705.0.g904.998915995202644e-173DEAD/DEAH box helicase
WormBaseWBGene000068881.0003503620230312e-57locus:vbh-1 status:Confirmed
UniProt:Q9N3F4 protein_id
:CCD72826.1
DictyBaseDDB_G02873612.9992141389250636e-57ddx41 on chromosome: 5 positio
n 183547 to 185657
SGDYPL119C2.000065869309806e-55DBP1 Putative ATP-dependent RN
A helicase of the DEAD-box pro
tein family; mutants show redu
ced stability of the 40S ribos
omal subunit scanning through
5 untranslated regions of mRNA
s
Stentor CoeruleusSteCoe_126033.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00105060(coding)
ATGAGTAAGAATTTTACAGGTGGAAAGAGAAATTTTGCAACTGCAAATGGAAATGGCAAG
GAATCATTTGGCGAAAAGCCTCGTAAGAACTTCATTACCTCTGAAGGTAAAAAGGATTTC
AAGCCCAAGAACAGGGATTGGGATTCTGAAAGTGAAGATGAAGACACCAAGAAGAACCAA
ATTGAGGCTAAGCACAACTAAGATAACATGAGTAAATATATTAAGAATGCCAAGACTATT
GAAATTCTTAACAAGAGAGGAATCACTTATTTGTTCCCTATTTAGGAGCACTGTTTCCAA
GCTATCCAAGCTGGTAAGGATCTTATAGGAAAAGATAGAACTGGCAGTGGTAAAACCCTC
GGTTTCTCTTTGCCTCTCATTGAAAAATTAAGAAATGAAGGTAATTTCACTAGCATCAAA
AAGAAACAAACTCCATATATGCTCGTTGTAGTTCCTACTAGAGAACTCTGTATCTAGGTT
GCAAATGAAATTAACACACTCAAGCACACTGACAATGAATTTAGAGTTTTACAAATTTAC
GGAGGTGTCGATGTTAGAGAGCAAGCAAATTAAATTAGAGATGGTGTTGAAATCGTTGTT
GGTACTCCTGGTCGTATCATTGATCAATATGAAAGAGGTGCTTTGATGTTCCACTCTATT
ATAGCCACTGTTTTAGATGAAGCCGATTAAATGCTTAACTTTGGTTTCTAAGAAGACATC
GAAAAGATCTTTGGATTTATCAAGAATGACAAGGGTGAAGAAAGACCTTAGAATTTGTTA
TTCTCAGCTACCATGCCTTCTTGGGTTCATGACATTGCTAGAAAGTTTTTGAGAGAAGAC
AGAGTTTTAATTGATTTAGTTAAGAATTTAGGTAACAAGACAAGTTAAGATGTCACTCAC
TTAGCCATCAACTGTCCTTACTTCTAAAGAACTGAAGCTATCGGAGATGTTATCTTATGC
TATGGTGGTGGTGCTCACTCCAGAGTCATCATCTTCTGTGAAACTAAGAATGAAGCAAAT
GAAATCATGCTTAAGGCAAATATTAAATAGGATGTTTAGGTACTCCATGGTGATATTCCT
TAAAAGTAGCGTGAAATCACATTCCAAGGGTTCAGAGAAGGTAAATTCAAGTGCTTAGTT
GCTACTAATGTTGCTGCTAGAGGTTTGGATATCCCTGAAGTTGATTTAATTGTCTAATTA
GAACCTCCCAAAGAACTTGATGCTTACATTCATAGATCTGGTAGAACAGGAAGAGCTGGT
AAGAAGGGTGTTTGCATTACCTTCTACACCAAGAAGCAATAATCTTTGATTGAAAGAATC
GAAAAGAAGTGTCACATTAAGATGCAAAAGGTCGGTGCTCCTCAACCAGCTGACCTTATT
CGTGCTTCTTAAAACGATATCAAAAAGAACCTTATGTCAGTTAACAGAACTGTTTTAGGA
ATATTCAAGGAAGTTTCAGTCGATTTAATTTAGGAATTCGGACCTGAAGAAGCTTTGGAA
CGTGCTATTGCATTCATCTCTGGTTTCACTGAAAAAATGAAATAACGTTCTTTATTATGC
TGTCTTGAAGGTTACGTTACTTATATTGTACGTACCCCAAGCGAATTTAGAGGTCTTGGC
TACATTTGGGGATGGGTTAAGAATAACTTCCCTGCTGAATGCACTGATAGAATCAAAGGT
ATGAAGAAGTTTGCAGATAACAAGGGTGCCGTCTTCGATGTTGCCGAAGAAGACAAAGAA
GTTTTCGATGCCTATATTAATGAATTAGCAGAAGGAACAAAGCAAGGTTTGGAATTAGAA
GTTGCTACTACTATTCCTGAAATCGAAGAAGAAGGTGGATATAGTTAAGGATACAACGGT
GGCAACAAGTCTGCTCCAAATGGATTCTCATTCACTAATACCAACCCTAAAATGGACCCC
AAGCTTAAGAGAGAACTTGAAATCTTCATTGGTGGCTTACCCTACGACTGCAAGGAAAAA
GATGTTACTTAACACTTTGATAAAAATGGTGTTTAATTCTCTTCTCTCCGTGCTCTTAGT
GGTGATGATGGCAAATTTAAAGGTATTATTTTCGCAATGTGTGCCAATTAAGCTGGTGTC
AAGAAGGCCTTGACCTTAGATGGATAAAAGTTCATGGGAAGACCTCTCAGAATTAACATG
GCTTGCAAAAAGTGA


>TTHERM_00105060(protein)
MSKNFTGGKRNFATANGNGKESFGEKPRKNFITSEGKKDFKPKNRDWDSESEDEDTKKNQ
IEAKHNQDNMSKYIKNAKTIEILNKRGITYLFPIQEHCFQAIQAGKDLIGKDRTGSGKTL
GFSLPLIEKLRNEGNFTSIKKKQTPYMLVVVPTRELCIQVANEINTLKHTDNEFRVLQIY
GGVDVREQANQIRDGVEIVVGTPGRIIDQYERGALMFHSIIATVLDEADQMLNFGFQEDI
EKIFGFIKNDKGEERPQNLLFSATMPSWVHDIARKFLREDRVLIDLVKNLGNKTSQDVTH
LAINCPYFQRTEAIGDVILCYGGGAHSRVIIFCETKNEANEIMLKANIKQDVQVLHGDIP
QKQREITFQGFREGKFKCLVATNVAARGLDIPEVDLIVQLEPPKELDAYIHRSGRTGRAG
KKGVCITFYTKKQQSLIERIEKKCHIKMQKVGAPQPADLIRASQNDIKKNLMSVNRTVLG
IFKEVSVDLIQEFGPEEALERAIAFISGFTEKMKQRSLLCCLEGYVTYIVRTPSEFRGLG
YIWGWVKNNFPAECTDRIKGMKKFADNKGAVFDVAEEDKEVFDAYINELAEGTKQGLELE
VATTIPEIEEEGGYSQGYNGGNKSAPNGFSFTNTNPKMDPKLKRELEIFIGGLPYDCKEK
DVTQHFDKNGVQFSSLRALSGDDGKFKGIIFAMCANQAGVKKALTLDGQKFMGRPLRINM
ACKK


>TTHERM_00105060(gene)
ATGAGTAAGAATTTTACAGGTGGAAAGAGAAATTTTGCAACTGCAAATGGAAATGGCAAG
GAATCATTTGGCGAAAAGCCTCGTAAGAACTTCATTACCTCTGAAGGTAAAAAGGATTTC
AAGCCCAAGAACAGGGATTGGGATTCTGAAAGTGAAGATGAAGACACCAAGAAGAACCAA
ATTGAGGCTAAGCACAACTAAGATAACATGAGTAAATATATTAAGAATGCCAAGACTATT
GAAATTCTTAACAAGAGAGGAATCACTTATTTGTTCCCTATTTAGGAGCACTGTTTCCAA
GCTATCCAAGCTGGTAAGGATCTTATAGGAAAAGATAGAACTGGCAGTGGTAAAACCCTC
GGTTTCTCTTTGCCTCTCATTGAAAAATTAAGAAATGAAGGTATGAAAATTTACAAATAT
TTAAGCAATTTAAACATTTACATTATATTTAAATTGTAAACTCTTAATAATTTATCTTTC
TCCATATTAACAGGTAATTTCACTAGCATCAAAAAGAAACAAACTCCATATATGCTCGTT
GTAGTTCCTACTAGAGAACTCTGTATCTAGGTTGCAAATGAAATTAACACACTCAAGCAC
ACTGACAATGAATTTAGAGTTTTACAAATTTACGGAGGTGTCGATGTTAGAGAGCAAGCA
AATTAAATTAGAGATGGTGTTGAAATCGTTGTTGGTACTCCTGGTCGTATCATTGATCAA
TATGAAAGAGGTGCTTTGATGTTCCACTCTATTATAGCCACTGTTTTAGATGAAGCCGAT
TAAATGCTTAACTTTGGTTTCTAAGAAGACATCGAAAAGATCTTTGGATTTATCAAGAAT
GACAAGGGTGAAGAAAGACCTTAGAATTTGTTATTCTCAGCTACCATGCCTTCTTGGGTT
CATGACATTGCTAGAAAGTTTTTGAGAGAAGACAGAGTTTTAATTGATTTAGTTAAGAAT
TTAGGTAACAAGACAAGTTAAGATGTCACTCACTTAGCCATCAACTGTCCTTACTTCTAA
AGAACTGAAGCTATCGGAGATGTTATCTTATGCTATGGTGGTGGTGCTCACTCCAGAGTC
ATCATCTTCTGTGAAACTAAGAATGAAGCAAATGAAATCATGCTTAAGGCAAATATTAAA
TAGGATGTTTAGGTACTCCATGGTGATATTCCTTAAAAGTAGCGTGAAATCACATTCCAA
GGGTTCAGAGAAGGTAAATTCAAGTGCTTAGTTGCTACTAATGTTGCTGCTAGAGGTTTG
GATATCCCTGAAGTTGATTTAATTGTCTAATTAGAACCTCCCAAAGAACTTGGTAATGAT
TAATTTATAATTATTTTAATAATAAATATTAAATAAATTTAATATTATTAAAAGATGCTT
ACATTCATAGATCTGGTAGAACAGGAAGAGCTGGTAAGAAGGGTGTTTGCATTACCTTCT
ACACCAAGAAGCAATAATCTTTGATTGAAAGAATCGAAAAGAAGTGTCACATTAAGATGC
AAAAGGTCGGTGCTCCTCAACCAGCTGACCTTATTCGTGCTTCTTAAAACGATATCAAAA
AGAACCTTATGTCAGTTAACAGAACTGTTTTAGGAATATTCAAGGAAGTTTCAGTCGATT
TAATTTAGGAATTCGGACCTGAAGAAGCTTTGGAACGTGCTATTGCATTCATCTCTGGTT
TCACTGAAAAAATGAAATAACGTTCTTTATTATGCTGTCTTGAAGGTTACGTTACTTATA
TTGTACGTACCCCAAGCGAATTTAGAGGTCTTGGCTACATTTGGGGATGGGTTAAGAATA
ACTTCCCTGCTGAATGCACTGATAGAATCAAAGGTATGAAGAAGTTTGCAGATAACAAGG
GTGCCGTCTTCGATGTTGCCGAAGAAGACAAAGAAGTTTTCGATGCCTATATTAATGAAT
TAGCAGAAGGAACAAAGCAAGGTTTGGAATTAGAAGTTGCTACTACTATTCCTGAAATCG
AAGAAGAAGGTGGATATAGTTAAGGATACAACGGTGGCAACAAGTCTGCTCCAAATGGAT
TCTCATTCACTAATACCAACCCTAAAATGGACCCCAAGCTTAAGAGAGAACTTGAAATCT
TCATTGGTGGCTTACCCTACGACTGCAAGGAAAAAGATGTTACTTAACACTTTGATAAAA
ATGGTGTTTAATTCTCTTCTCTCCGTGCTCTTAGTGGTAAGAAATTTATTTATTTATTTT
TCTATATAAAGTCTTTTTAGGTTTTATAAAGCATATACTGATCAAAAAGAATATTTTTGT
AAATAAAACAAATGCATTCACAAACATTCATTTGAAGTTAAAGTTACAATTTATTAAAAT
TATTTCTAAATAAAATAGGTGATGATGGCAAATTTAAAGGTATTATTTTCGCAATGTGTG
CCAATTAAGCTGGTGTCAAGAAGGCCTTGACCTTAGATGGATAAAAGTTCATGGGAAGAC
CTCTCAGAATTAACATGGCTTGCAAAAAGTGA