Identifiers and Description

Gene Model Identifier

TTHERM_00095530

Standard Name

DRH10 (DExD/H box RNA helicase 10)

Aliases

PreTt22852 | 7.m00301

Description

DEAD/DEAH box helicase family protein. Sequence similarity to a protein kinase family unique to Tetrahymena thermophila (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00095530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000120599.997093137033517e-262Putative ATP-dependent RNA hel
icase T26G10.1 status:Confir
med UniProt:P34580 protein
_id:CAA82362.1
Tetrahymena borealisEI9_00258.19.997093137033517e-262DEAD/DEAH box helicase (522 aa
)
DictyBaseDDB_G02801479.997093137033517e-262ddx47 on chromosome: 3 positio
n 3015956 to 3017596
OxytrichaContig22569.0.g639.997093137033517e-262DEAD/DEAH box helicase
SGDYHR065C2.0000633521090825e-149RRP3 Protein involved in rRNA
processing; required for matur
ation of the 35S primary trans
cript of pre-rRNA and for clea
vage leading to mature 18S rRN
A; homologous to eIF-4a, which
is a DEAD box RNA-dependent A
TPase with helicase activity
Stentor CoeruleusSteCoe_164505.440559879258653e-75

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00095530(coding)
ATGTCAACTAAACAAATTCAGAAAAAAGCCAACACAGCAGTTCAAAGCAAGAAATCTTAA
AAGATAGAAGAAAAGAAAAAAGATTAGCTTAAGAAACTTGCTGAAGAAGAAGATGAAGTA
GAATAAAGTAGTGACGAAGAACAAGAAGAATCCTAAGAATTAAATGATGATTCAGCTGAA
AAATAATAGGCTAAACAAGAAAATAAGAATGGAGATTAAGAAAATAAAAGCGGAAGCGAA
TACTTAAAAGAAATTTAAATTGATGAAACTGAAGAAAAAGAAGATGTGACCTTTTAAAGC
TTAGGAGTTTGTGAAGAATTAGTAGAAGCTTGCAATAGATTAAAATATGTGAAACCCACT
GCAATTTAAAGAGAATCTTTAGTTTATACATTAAAGCAAAGAGATATTATTGCTTTAGCA
GAAACAGGTTCTGGTAAAACTTTAGCTTTTGCTTTACCTGTTATTCAAAATTTGTTAGAT
GCTCCTCAACCTTTCTACGCTTTAGTTCTTTCTCCTACAAGAGAATTGTGTATGTAAATT
GCTGAGCACTTTGAAGCTTTGGGTGTTGGTATAAGCTTAAAGACAACAGTTATTGTTGGT
GGTCTTGATCCTATGGCTTAGGCTATTGCTCTCTCTAAAAAGCCCCACATCATCATTGGT
ACTCCAGGTAGAATACTTTATCACATGCAAAACACCAAAGGATTTAATTTCAAGGCACTC
AAGTTCTTAGTTTTGGATGAAGCTGATAAGTTATTGAATATGGATTTCGAAAAGGATATC
AACCAAATTTTGGATATCATTCCTAAAAAGCGTAACACATTCTTATTCTCTGCCACTATG
ACTAATAAGGTTCATAAGCTTCAGAGAGCTTCACTCAAAGATCCTGTTAAAATTGAAGTT
TCTTCAAAGTATCAAATGGTTTCAACTTTAGTTGCTTAGTATGCTTTCATACCTGCCAAG
TACAAAGACTGCTACCTTGTCTATTCCCTCAATGAATTTGCAGGAAACACCTCAATTATT
TTCGTTCAAACTTGCTTAAATGCTATCAAGTTAACTTTGATGCTTAGAAATCTTGGATTC
TCAGCTGTTACTATCCATGGTTAAATGAGTTAGGTCAAGCGTTTGGGTGCTATTAATAAA
TTTAAATCAGGAGAGAAAAAAATATTAGTTGCTACTGATGTTGCTTCTAGAGGTTTAGAT
ATTCCAAGTGTTGATTTAGTTATAAACTACGATATTCCTACAAATGCCAAGGAATACGTC
CACAGAGTAGGTAGAACTGCAAGAGCTGGTAGAGCTGGTAAAGCCATTAGCTTTGTTACT
CAATATGATGTTGAAATGTATTTAAAGATTGAAGCTTTGATTGGTAAAAAACTTGATCAA
TATAAATGTGAAGAATATTAAGTTTTAGTTTTCAACGAAAGAGTTTAAGAAGCTCAAAGA
ATCGCTGCATAAGAAATAAAAGAAATTATGGAAAAAAAGAACAATCCTCTCCATGATGTT
GATGATGAAGGTGAAAAATACAGTAAGAAAAATGCAAATAACAACAGAAAGAAAAGCTTC
AATAATTCTAAGAATATGAAAAAAATGAAAATAGATATTTGA


>TTHERM_00095530(protein)
MSTKQIQKKANTAVQSKKSQKIEEKKKDQLKKLAEEEDEVEQSSDEEQEESQELNDDSAE
KQQAKQENKNGDQENKSGSEYLKEIQIDETEEKEDVTFQSLGVCEELVEACNRLKYVKPT
AIQRESLVYTLKQRDIIALAETGSGKTLAFALPVIQNLLDAPQPFYALVLSPTRELCMQI
AEHFEALGVGISLKTTVIVGGLDPMAQAIALSKKPHIIIGTPGRILYHMQNTKGFNFKAL
KFLVLDEADKLLNMDFEKDINQILDIIPKKRNTFLFSATMTNKVHKLQRASLKDPVKIEV
SSKYQMVSTLVAQYAFIPAKYKDCYLVYSLNEFAGNTSIIFVQTCLNAIKLTLMLRNLGF
SAVTIHGQMSQVKRLGAINKFKSGEKKILVATDVASRGLDIPSVDLVINYDIPTNAKEYV
HRVGRTARAGRAGKAISFVTQYDVEMYLKIEALIGKKLDQYKCEEYQVLVFNERVQEAQR
IAAQEIKEIMEKKNNPLHDVDDEGEKYSKKNANNNRKKSFNNSKNMKKMKIDI


>TTHERM_00095530(gene)
ATGTCAACTAAACAAATTCAGAAAAAAGCCAACACAGCAGTTCAAAGCAAGAAATCTTAA
AAGATAGAAGAAAAGAAAAAAGATTAGCTTAAGAAACTTGCTGAAGAAGAAGATGAAGTA
GAATAAAGTAGTGACGAAGAACAAGAAGAATCCTAAGAATTAAATGATGATTCAGCTGAA
AAATAATAGGCTAAACAAGAAAATAAGAATGGAGATTAAGAAAATAAAAGCGGAAGCGAA
TACTTAAAAGAAATTTAAATTGATGAAACTGAAGAAAAAGAAGATGTGACCTTTTAAAGC
TTAGGAGTAAAATTTAAATTAATATTTTGAAAAAAATATCATTTTTGTACATAAAATTAA
TGTTTAGGTTTGTGAAGAATTAGTAGAAGCTTGCAATAGATTAAAATATGTGAAACCCAC
TGCAATTTAAAGAGAATCTTTAGTTTATACATTAAAGCAAAGAGATATTATTGCTTTAGC
AGAAACAGGTTCTGGTAAAACTTTAGCTTTTGCTTTACCTGTTATTCAAAATTTGTTAGA
TGCTCCTCAACCTTTCTACGCTTTAGTTCTTTCTCCTACAAGAGAATTGTGTATGTAAAT
TGCTGAGCACTTTGAAGCTTTGGGTGTTGGTATAAGCTTAAAGACAACAGTTATTGTTGG
TGGTCTTGATCCTATGGCTTAGGCTATTGCTCTCTCTAAAAAGCCCCACATCAGTAATTT
CTTTTAAATTTTAAAATATGAAAATATAAAATTAAATTTTGCTATTTTGAAGATTTAAGT
GTACTTAATTAGTTTATACACTTACTTGAACTTGTAGCAATTATTATTCATACTATTTTT
GCAAAACCAGTGAAATGAATATAAAGAAATTAATTGCTTTGTTTTAATAAATAGTCATTG
GTACTCCAGGTAGAATACTTTATCACATGCAAAACACCAAAGGATTTAATTTCAAGGCAC
TCAAGTTCTTAGTTTTGGATGAAGCTGATAAGTTATTGAATATGGATTTCGAAAAGGATA
TCAACCAAATTTTGGATATCATTCCTAAAAAGCGTAACACATTCTTATTCTCTGCCACTA
TGACTAATAAGGTTCATAAGCTTCAGAGAGCTTCACTCAAAGATCCTGTTAAAATTGAAG
TTTCTTCAAAGTATCAAATGGTTTCAACTTTAGTTGCTTAGTATGCTTTCATACCTGCCA
AGTACAAAGACTGCTACCTTGTCTATTCCCTCAATGAATTTGCAGGAAACACCTCAATTA
TTTTCGTTCAAACTTGCTTAAATGCTATCAAGTAACAAATAAATAAAAACAATTTTTGAA
TTTATTTTTAGAATTAAATTTACTAACAAATTAGGTTAACTTTGATGCTTAGAAATCTTG
GATTCTCAGCTGTTACTATCCATGGTTAAATGAGTTAGGTCAAGCGTTTGGGTGCTATTA
ATAAATTTAAATCAGGAGAGAAAAAAATATTAGTTGCTACTGATGTTGCTTCTAGGTAAT
TAAATTAATTGATAATTTTATATGTCTTTCTGTATAAAGATTTTTGATTAAATTTTATAT
TAAATAATATATAGAGGTTTAGATATTCCAAGTGTTGATTTAGTTATAAACTACGATATT
CCTACAAATGCCAAGGAATACGTCCACAGAGTAGGTAGAACTGCAAGAGCTGGTAGAGCT
GGTAAAGCCATTAGCTTTGTTACTCAATATGATGTTGAAATGTATTTAAAGATTGAAGCT
TTGATTGGTAAAAAACTTGATCAATATAAATGTGAAGAATATTAAGTTTTAGTTTTCAAC
GAAAGAGTTTAAGAAGCTCAAAGAATCGCTGCATAAGAAATAAAAGAAATTATGGAAAAA
AAGAACAATCCTCTCCATGATGTTGATGATGAAGGTGAAAAATACAGTAAGAAAAATGCA
AATAACAACAGAAAGAAAAGCTTCAATAATTCTAAGAATATGAAAAAAATGAAAATAGAT
ATTTGA